KEGG   Trichinella spiralis: Tsp_06305Help
Entry
Tsp_06305         CDS       T01609                                 

Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
tsp  Trichinella spiralis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Tsp_06305
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Tsp_06305
Messenger RNA biogenesis [BR:tsp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Tsp_06305
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Tsp_06305
Translation factors [BR:tsp03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Tsp_06305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 219 aa AA seqDB search
MEIVHSSDDSLESVSDPEYFLDQLYDERFTNSENGFEEEESGIESLYNFSLTDMVKHPLQ
HTWVLWYLTNDRKISWEDRLKEVASFNTVEDFWALYNFIQKASSLPNNSDFYYFKEGVRP
MWEDPRNKNGGRWIIRIDRSEEGRVLDECWLDLVMAVLGEQFSGLGAEICGVAVNVRSKG
HKVCLWTANADSDENREIGYMMHSLLDSASYVKFERHLE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgtgcattcctctgatgatagtttggaatctgtttccgaccctgaatatttt
ttagaccagttgtacgatgagcgttttacaaattcggaaaatggcttcgaagaagaggag
agtggcattgaaagtctttacaacttttctttgacagacatggtgaaacatcctctgcag
catacttgggtactgtggtacctcacaaatgatcgtaaaataagttgggaagaccgtttg
aaggaagttgcatcattcaatacagtagaagacttttgggctctgtacaattttatacag
aaggccagctctcttccaaacaatagtgatttttactatttcaaagaaggggtgcgtccg
atgtgggaagaccctcgtaataaaaatggtggtcgatggataattcgtattgatcgctca
gaagaagggagagttttagatgaatgttggttagatttagtgatggctgtacttggtgaa
caattcagcggtttgggtgcagaaatttgtggtgttgcagtcaacgttcgttcgaaaggt
cacaaagtatgcttgtggactgcaaatgccgacagtgacgaaaatcgtgaaataggctac
atgatgcacagcttgttggactcagccagctatgttaaattcgaacgacacttggaataa

DBGET integrated database retrieval system