KEGG   Trichinella spiralis: Tsp_06325Help
Entry
Tsp_06325         CDS       T01609                                 

Definition
(RefSeq) enoyl-coa hydratase FadB1x
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tsp  Trichinella spiralis
Pathway
tsp00062  Fatty acid elongation
tsp00071  Fatty acid degradation
tsp00280  Valine, leucine and isoleucine degradation
tsp00310  Lysine degradation
tsp00380  Tryptophan metabolism
tsp00410  beta-Alanine metabolism
tsp00640  Propanoate metabolism
tsp00650  Butanoate metabolism
tsp01100  Metabolic pathways
tsp01200  Carbon metabolism
tsp01212  Fatty acid metabolism
Module
tsp_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
tsp_M00085  Fatty acid biosynthesis, elongation, mitochondria
tsp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tsp_06325
   00650 Butanoate metabolism
    Tsp_06325
  Lipid metabolism
   00062 Fatty acid elongation
    Tsp_06325
   00071 Fatty acid degradation
    Tsp_06325
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tsp_06325
   00310 Lysine degradation
    Tsp_06325
   00380 Tryptophan metabolism
    Tsp_06325
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tsp_06325
Enzymes [BR:tsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tsp_06325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 10908583
NCBI-ProteinID: XP_003378422
UniProt: E5SFS7
Position
Unknown
AA seq 292 aa AA seqDB search
MFAIHKSLAVSRNLSCIVKTAMSIQLKRSTFTSNYSFIKCDIVGEESNVGLVQLNRPKQL
NALCKPLFAEIACALEGFQNDPAIKAVVITGSDKAFSAGADIDEMKNLHFSDAFKNTALD
VWNSVSEFKKPIIAAVRGYALGGGCELAMMCDIVYAAENAQFGQPEVTIGTIPGAGGTQR
LIRAVGKSLAMEMILSGARINANEAKAAGLVSKVYPVENVLNEAIATAQRIGKLSPIIVS
IAKKSIQKAFETSLKDGLDFERHLFNSTFATEDQKEGMDAFLKKRKPQFTGS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccattcataagtctctggcagtatcaagaaatctttcctgtattgtcaaaacg
gcgatgtcaatccaactgaaaaggtctacattcacatcaaattattccttcataaaatgc
gatatagttggagaagaatcaaatgttggactcgttcagttaaatcgaccgaagcaattg
aatgcactttgcaaaccgttgtttgctgaaatcgcttgtgcattggaaggctttcaaaat
gacccagccatcaaagctgtcgtcattaccggatctgataaagcattctctgctggtgct
gatattgatgaaatgaaaaatcttcacttttccgatgctttcaagaataccgctttggat
gtgtggaattctgtttcagaatttaaaaaaccgatcattgcagctgttcgcggttatgcg
cttggaggtggatgtgaattggcaatgatgtgtgacattgtttatgcggctgaaaatgct
caatttggtcaacctgaagtcaccatcggtaccataccaggagctggtggaactcagaga
ttaattcgagccgtagggaaatctttggctatggaaatgattcttagtggggcaagaatt
aatgcaaatgaagcgaaagcggctggtttggtgagcaaagtttatccagttgaaaatgta
ctcaatgaagcaattgccacagctcaacgtattggaaaattatcaccaattattgtatca
attgctaaaaaatcaattcaaaaagcattcgaaacatcactgaaagacggtttggacttt
gaacgtcatttgttcaactctacatttgcaacggaagatcaaaaagaaggaatggatgca
tttttgaagaaacgaaaaccacaattcaccggttcttaa

DBGET integrated database retrieval system