KEGG   Trichinella spiralis: Tsp_06623Help
Entry
Tsp_06623         CDS       T01609                                 

Definition
putative integrin alpha pat-2
Orthology
K06584  
integrin alpha 8
Organism
tsp  Trichinella spiralis
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Tsp_06623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1101 aa AA seqDB search
MFPLTVRLVKLTLECFNFLLIGAPKAESGQPGVRRGGAVFRCETKDQRCTKIFFDTAGHA
RALNGSVLLQIDSKSDQWFGATVVSSKKGDAVLACAPRYTYFYSTFDRKEPVGTCYLAQD
NFSSFREYAPCRIETRWGYHRLGSCMAGFSAAISDLYKHYVQFQQENKLYIGAPGAWYWQ
GSLVMQEIGRDDMVKRTSEGPAYLDDTYMGYSMAVGDFKGNSDNHVAVGVPKGNFLTGMV
VLFDSNLKVLQNITGHQVGSYFGAALAVGDFNDDGLDDIAIGAPLFIGMENKQLDKSQTE
GKYEVGAVYVYFQDKQHHFVKYTTLVGLKEWSRFGHDVAAVGDLNGDSFDDIVIGAPYDG
EDRKGAVYVYHGMKDGIKEKFSQVIYARDIDPSLRTFGWSVTGGVDIDNNDYPDVLVGAY
SSDRSVLFRTRPVVSVSGFVKILLIWKISFVGFFEQKMLHDFRIIVSLDPKKGISSRARF
LESHSVTQLTLDSVPIRKGERWCERRYVYVLDDIRDKLSPITVQVNYSIVDEGYMERQLR
PVMDAYIPSMISGEINIQKDCGKDNICIPDLQMTAKLNRESILIGADDRFNVSVVIHNAL
EDAFEAQFFIVAPVGLDYEGFTRQMPSRPITCSQPKELNNGKNYVIACDVGNPLPKSSTV
RFSMQFSTENLDLVMGGISLNLTTNSTNNETERTLVDNEVLLVIPMEVKADFIVTGVSRN
ESYHYDFNDRRDDFVFDSDAGPVVSHVYEIRNLGPSTLSEMSVDVYWPSYFVDNAKPLLY
LIDDIETEGKITCELLQKGHINSEGLIIVPRPEDAIERVFRVKRQEKANSRQRYEEKSDV
LKALRNAMALMKQSLGDFGNAFGQMRNVLQRVRLVIDCRLKIASKRISYGINCMEMACSQ
WQCKIKDFKKDERVLLKVDSRLWLNTLIDEVFYDAMISSLVIAEVTKLPYRHPTIELPLR
YAVASTIVNPKDPTRVSRGVPTWLIFVAILAGLTSLILLIMLLWKFGFFKRKRPPRGQAL
LSKPPEPEYYGYSSYSSAQTPGGYTTYGNPHYEQTLYHLTAPTKVQSSCRACCMHVLMYY
ICHRVCLRMIAKNEWGSRQMN
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgtttccactaactgttcgtctagttaagctaactttggagtgcttcaacttcttatta
attggtgccccaaaagctgaatcaggccagcctggagttcgacgtggtggtgcagttttt
cgttgtgaaaccaaagaccaacgatgcactaaaatattttttgataccgctggacatgcc
cgtgctctgaatggttcagttttacttcaaattgattctaaatctgatcagtggtttgga
gcaacggtggtgagctcaaaaaaaggtgatgctgttctggcttgtgccccacgttataca
tatttttattccacttttgatcgtaaagaacccgttggaacgtgctatttagcacaggat
aatttcagctcttttcgagaatacgctccttgtcgaatagaaacaagatggggttatcac
cgtttaggttcctgcatggctggattcagcgctgccatttcagatctttataaacattat
gttcaatttcagcaagaaaacaagctgtacattggtgctccaggtgcctggtattggcaa
ggatcacttgttatgcaagaaattggtcgtgacgatatggtaaagcgtacatctgaaggt
ccagcatacttggatgatacatacatgggctattcgatggctgtgggagattttaaaggt
aattcagacaaccatgttgctgttggtgtaccgaaaggaaattttcttactggaatggtt
gttctgttcgacagtaatttaaaagtattgcaaaatattactggccatcaagttggttca
tattttggagctgcactagctgttggagatttcaatgacgatggtttggatgatattgct
attggtgcgccgctatttattggcatggagaacaaacagctcgataagagtcaaacagaa
ggaaaatatgaagttggagcagtatatgtatactttcaagacaaacagcatcattttgtg
aaatacaccacattggtgggacttaaagaatggtcacgctttggtcatgacgtagctgca
gttggagatctgaatggcgattcattcgatgatattgttattggcgcaccatacgatggt
gaagatcgtaaaggtgctgtatatgtgtatcatggtatgaaagatggaattaaagaaaaa
tttagtcaagttatatacgccagagatattgatccatctctaagaacgtttggctggtca
gtcacgggaggtgtcgacattgataacaatgattatcccgatgttcttgttggagcttac
agttcagatcggtccgtattgtttaggactcgtccggttgtttctgtatctgggtttgtt
aaaatactgttaatttggaaaataagctttgtcggctttttcgaacagaaaatgttacat
gattttcgtattattgtcagtttggatccaaaaaaaggaatcagtagtcgagcacgtttt
cttgaaagccacagcgtcactcaactaactttggattctgttcctattcgtaaaggagag
cgatggtgcgagcgacgttacgtttatgtcctagatgacattcgggataagcttagtcca
attacagttcaagtaaattacagtattgtggatgaaggatacatggaaaggcagctgcgt
cctgtcatggatgcttacattcccagtatgatttctggagaaattaatattcaaaaagac
tgtggaaaagataatatttgtattccagatttgcagatgactgctaaattgaatcgcgaa
tccattttaattggtgctgatgatcgatttaatgtatcagtggtgattcacaatgcttta
gaagatgcattcgaagctcagtttttcatagttgctccagttggtctagattatgaaggt
tttacacgtcaaatgccttctcgtcccattacttgttcacaaccgaaagagttgaataat
ggaaaaaattacgtcattgcttgtgatgttggtaatccgcttccgaaatcatcgactgtg
cgattcagcatgcagttttcgacagaaaatttagatttagttatgggaggaattagttta
aatctaacgacaaacagtaccaacaatgaaactgaaagaacgctggtagacaatgaagtg
ttgttggtcattcccatggaagtaaaagctgattttattgtcactggggtatcccgaaat
gaatcgtatcactacgactttaacgaccgtcgagatgattttgtttttgacagtgacgct
ggacctgtggtttcacatgtttatgagataagaaatcttggaccttcaacattgtctgag
atgtcagtagatgtttattggccaagttattttgtggacaatgcaaaaccattgttgtat
ttaattgatgatattgaaactgaagggaagatcacttgcgaacttttgcaaaaaggccat
ataaattcagaagggttaataattgttcctcgtccagaggatgctattgaaagagtgttt
cgagtgaaacgtcaagaaaaagcgaacagccggcaacggtacgaggaaaaatctgacgtg
ctgaaagctctccgtaatgcaatggctttgatgaagcaaagtttgggtgatttcggtaat
gcatttggtcaaatgcgtaatgtactgcagcgtgttcgactggtgatagattgtcgttta
aaaatagcatcgaaaagaatatcttatggaataaattgcatggaaatggcctgttcacaa
tggcagtgcaaaataaaagattttaagaaagatgaaagagttctgttgaaagtggattct
cgcctttggctcaacacattaattgatgaagttttttatgatgcaatgatatcatcactt
gtaattgcggaagtaacaaaactgccctacagacatcccacaattgaacttccattacgt
tatgctgttgcaagtacgatagtaaatccaaaagatccaactcgtgttagtcgtggtgtg
ccaacttggctaatatttgttgccattttagctggtttaacaagtcttattctgctcatc
atgcttttatggaagtttggattcttcaagcgtaagcgacctccacgaggacaagctcta
ctgtccaagccgccagagccagaatattacggatatagtagttatagcagtgctcaaacg
ccaggtggatataccacatatggaaatccacattacgaacagacactatatcatttgaca
gcaccaacaaaagtacagtcgtcatgtcgtgcatgttgtatgcatgtacttatgtattat
atatgtcatcgtgtatgtttgcgtatgatcgctaaaaatgaatggggcagcagacaaatg
aattga

DBGET integrated database retrieval system