KEGG   Trichinella spiralis: Tsp_06631Help
Entry
Tsp_06631         CDS       T01609                                 

Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Tsp_06631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 433 aa AA seqDB search
MTHNSNKLTSAEFSYLSMDLDRNFRMEVSVPDSIMAVEAVRFALVPPDGFESERNWFKPR
YASAIFETDEVIFGYNMVDIRILLSACDLKINIDYDFEMKAPSGSRGTCDDIGKFMKKCL
PEDSLVTHDFKNAVHDQWDFKPYGELIYSYTSEEDEKKKTFEIYHVAKPNESFLAYLKRM
QYCALWFIEGLSFTDTNDECWHYFVLLEKVTNNGRVYYASMGYCSVYDFYAYPDGIRSRI
GQFFIFPPFQKKGHGAKFLQSVLNALRCEPRVLEITVEDPVNEFLKLRDFIDAKNCSGLS
LFQPENLKGGFTNDMALEALKKLKIHCKQARRVYEILRLGCTNMFDKNEFKAYRLDVKRN
IMKIYNIEQADLEGIQGNLDMNVKNSLIKKDRSERYKVLQEAFERLMQDYKPVVDRLKKM
ESLPPAIFIGGSS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacacataactcgaataaacttacatcagctgaattttcatatctcagtatggatctt
gatagaaactttcgaatggaagtatctgttcctgacagcattatggctgtggaagctgtt
cgatttgctttggttccaccggatggatttgaatccgaaagaaattggttcaagcctaga
tatgcaagtgcaatatttgaaacagatgaagtgatatttggttataatatggtcgatatc
cgaatactactttcggcttgtgatttgaaaataaacattgattacgacttcgaaatgaaa
gcaccttctggttccaggggcacgtgtgatgatattggaaagtttatgaagaaatgtttg
cctgaggattcgttggtcacgcatgatttcaagaatgctgttcatgatcagtgggatttt
aagccgtacggtgaactgatttatagctatacaagtgaagaggatgagaaaaagaagact
tttgaaatctatcatgtcgccaagccgaatgaaagttttctggcatatttgaaaagaatg
cagtattgtgcactttggtttattgaaggattaagttttactgatacaaatgacgaatgt
tggcactactttgttttactcgaaaaagtgacaaataatggccgagtttattatgcatca
atgggatactgcagtgtgtatgatttttatgcatacccggatggtattcgttctcgtatt
ggacagttttttatttttccaccatttcaaaaaaaaggacatggtgcaaagtttttgcaa
agtgttttgaatgctcttcgttgcgagcctcgcgttttggaaattacagttgaagatcca
gttaacgaatttttaaaattgcgtgattttattgatgcgaaaaattgcagtgggttgtct
ttatttcaaccagaaaatttgaaaggcggttttaccaatgatatggcattggaggcgttg
aaaaagttgaaaatccattgcaaacaggctagacgtgtttatgaaattttgcgtcttggt
tgcaccaacatgtttgataaaaatgaattcaaagcttatcggttagatgtgaagcgcaac
atcatgaaaatttacaatatagaacaagctgatttggaaggcatacaaggaaatttggat
atgaacgtgaaaaacagcttgataaagaaggatcgcagcgaacgttacaaagtcttgcaa
gaagcttttgaaagattgatgcaagattacaaacctgtggtggatcgtttaaagaaaatg
gagagccttccacctgctattttcatcggtggatcgtcttaa

DBGET integrated database retrieval system