KEGG   Trichinella spiralis: Tsp_06701Help
Entry
Tsp_06701         CDS       T01609                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tsp  Trichinella spiralis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tsp01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tsp00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tsp00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 477 aa AA seqDB search
MTFASFWAAKYGVTTRTRDNCLSVREHRCYLETPLALYIHKELQSYCNYQITLYSSSLSS
LTTNTTWIDRTTMLTFTKRFSLLFRTLTNLPKQYVQAVSIKKITSTSAKDAVIRKCAFDR
EKGDYVEVDELIAEIETDKTSVEVRAPHSGIITEILIPDGEKVIAKQLLSRLDVSAPAPD
GKASSVPQPPPPPTAAPTPTAAAHPAERTTITTPSPPPPPPPLSTYVPSGVSSVEQQQQR
TDIVGIRTEHRVKINRMRSRIGQRLRDAVNTFVMLTTFNEVDMSALMEMRKRHNEQFQKK
HGVKLGLMSPFIKAASYALIEQPVVNAVIDESEIVYRHFVDISVAVASERGLVVPVIRNV
ESMSYAEVEKAIAQYAKLASVIARENRLAIEDMAGGTFTVSNGGVFGSLFSTPIINPPQS
AILGLHAINDKPVIEIRPMMYIALTYDHRLIDGREAVTFLRKIKLAIEDPTIMLLNL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacatttgcctccttttgggcggcaaagtacggtgttacaacccgaacacgtgacaac
tgtttgagcgtgagagaacaccgttgttatcttgaaacaccccttgcactttatatccat
aaagagctgcagtcgtactgtaattatcaaatcaccctctattcgagtagcttaagtagt
ttgacaacaaatactacgtggatagatagaacaacgatgcttacattcaccaagcgcttc
agcttgctgtttcgaacactgaccaacttaccaaaacagtacgtacaggctgtttcaatt
aagaaaatcacatccacaagtgcgaaagatgccgttattcgaaaatgtgccttcgatcgt
gaaaaaggtgattacgtggaagtggatgaattaatagctgaaatcgagaccgacaaaact
agcgtagaagtgcgtgctccgcacagcggtattatcacagaaattctgattccagacggc
gagaaagtcattgctaagcagcttctttcacgtctggacgtatctgcaccagctcctgat
ggtaaggcctcttcagttcctcagccgcctccaccacccactgctgctccaactccgaca
gcggcagctcatccagctgaaagaacaaccatcactactccatctccacccccacctccc
cctccactttcgacatacgttccttcgggggtatcttcggtagaacaacagcaacaacgc
accgatatagttggcattcgtacagagcacagggtgaaaattaaccgcatgcgttccaga
attggtcaacgtctcagggatgcagtgaacacctttgtaatgctgaccacgttcaacgaa
gtcgacatgagtgctttgatggaaatgcgtaaacgacacaacgagcagtttcaaaaaaag
catggcgttaagttgggcttgatgtcgccgttcatcaaagcagcctcttatgctttgatt
gaacagccagttgttaatgctgtgattgatgaaagcgagattgtgtatcgtcatttcgtg
gatatcagcgtggcggtggcaagcgaacggggtttagtagttccagtgattcgaaacgtc
gagtcgatgtcctatgcagaggttgaaaaagcaattgcacaatatgcaaaattggcaagt
gttattgctcgagaaaatcgtttagcaattgaagatatggccggcggtacgttcaccgtt
tctaacggaggagtgttcggttcgctgttcagcacgccgatcatcaatccacctcagtca
gccattctcggtctgcatgcaataaacgacaagccagttatcgagattcgtccaatgatg
tacatcgcgttgacttatgatcatcgcctgatcgacggccgtgaagcggtgacgtttttg
cgaaaaatcaaacttgcaattgaagatccgactatcatgctattgaacttgtag

DBGET integrated database retrieval system