KEGG   Trichinella spiralis: Tsp_06746Help
Entry
Tsp_06746         CDS       T01609                                 

Definition
mRNA export factor
Orthology
K14298  
mRNA export factor
Organism
tsp  Trichinella spiralis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Tsp_06746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 445 aa AA seqDB search
MFCQLQVFFDLCLSIMFSSLTSSALRPTSTPFAAAAALSSSAGAHNPNKDFEVVQPPDDT
VQALKFSPPALAQNFLVSGSWDNVLRVWEVKQDGSTEPKAEQRIQGPVMQVDWSDVKHSS
FCNIRDGTKIFVASADRQVRVWDVSSNQMATIGQHDQTVSTCNWVHSPTYSCLITGSWDK
TVKFWDMRTPNTPAGVVSMPERVYFVDVLYPMGVACLANREIKIYKLDGQPVEVKSMESP
LKYQTRSVSIFKDKTNGAPVGYAVGSLEGRVAIQYVETVDPKANFTFKCHRSPELVNGFQ
EIYSVNDIAFHPQHGTLATVGSDGRYSFWDKDARTKLKMSEKLQNSITRCCFNKTGDIFA
YAVGYDWSKGHEFHNPQTKNYIFLHACFEDLKPRMTKSNCFLNVQKNNRDLDIRRTRRQF
SAQTTGRRRILMISLLFKASKGANN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtcagcttcaagttttctttgatctttgcctatcaattatgttttcctcactt
acaagcagtgctttgcgcccaacttctaccccgtttgctgctgctgcggcgttgagtagt
tctgctggtgctcataatccaaataaagatttcgaagttgtgcaaccgcctgatgacact
gttcaagcgttgaagtttagtccgccagcgcttgcgcaaaattttttagtatctggcagc
tgggataatgtactccgagtgtgggaagtgaaacaggatggatcaacagagcctaaagct
gagcaacgaattcaaggaccggtgatgcaagttgactggtctgatgtaaagcattcttca
ttttgcaatattcgagatggtactaagatttttgttgcatcagcagatcgccaggtccgt
gtttgggacgtttcaagcaatcagatggctaccattggtcagcatgatcaaacagtttca
acctgcaattgggtgcactcccccacatatagctgtttaattacaggttcatgggacaaa
acagtcaagttttgggatatgagaactccgaacactcccgctggtgttgttagcatgcca
gaacgcgtttattttgttgacgtgttgtatccaatgggcgttgcttgtcttgcgaataga
gagatcaaaatttacaaattggacggtcagcctgttgaggtgaagtcgatggaatcgcca
ctgaagtatcaaactcgaagcgtgagcatttttaaagataaaacaaatggtgcacctgtt
ggttatgcagtgggatccctcgaaggacgtgtagctattcagtatgtggaaactgttgat
cctaaagcgaattttacattcaaatgtcatcgatctccggaattggtcaacggttttcaa
gaaatttattccgtgaatgatatagcgtttcatccacagcatgggactttggctactgtt
ggatcggacggtcgttattcattttgggataaagatgcacgaacaaagttgaaaatgtca
gaaaaacttcagaattcaataacacgttgctgtttcaacaagactggagatatatttgca
tatgccgttggatacgattggtcaaagggtcacgagtttcacaatcctcagacgaaaaat
tatattttcttgcatgcttgttttgaagatttaaagcccagaatgacgaagagcaattgt
tttttaaatgtgcaaaaaaataatcgagatctcgacattcggcgtacgcgaaggcaattt
tcagcgcagacgacaggacggcggcgcattttgatgataagcttgctttttaaagcttca
aaaggggccaataattga

DBGET integrated database retrieval system