KEGG   Trichinella spiralis: Tsp_06964Help
Entry
Tsp_06964         CDS       T01609                                 

Definition
probable elongator complex protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Tsp_06964
Transfer RNA biogenesis [BR:tsp03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Tsp_06964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 565 aa AA seqDB search
MPPKGKDNQAELMALTVTEIVAILIEAQQKGEDVNLNKLKCAVSVKYGLKSQPKLVDIIA
AVPMSHRELLLPKLKAKPKNENSNNSCEVVIVFAQVRTASGIAIVAVMCKPHRCPHIYVT
GNVCSYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQAKGRLLQLQQLGHSIDKV
EYIVMGGTFMSLPDDYRDYFIRNLHDALSGHTSRNVAEAVRYSERSKVKCIGITIETRPD
YCLQRHLSQMLSYGCTRLEIGLQSIYEHVARDTNRGHTVKAVCEAFRYAKDAGFKVVAHM
MPNLPNVSYEEDLHQFRELFENPDFRPDGLKIYPTLVIRGTGIYELWKRGKYKSYPAETL
IELLAKILEIVPPWVRVYRVQRDIPMPLVSSGVTYGNLRELVLARMKELGTKCRDVRTRE
VGIQEIHNKVRPKNIELIRRDYEANGGLETFLSFEDPEQDILVGLLRLRKIPDDSPNKQP
ELAGYRCSMVRELHVYGSVVPISSRDPDKFQHKGYGIQLMKEAERIAREEHKSEKLSVIS
GVGTRNYYRKLGYELDGPYMSKMLT
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaggcaaagacaaccaagctgaattgatggcgttaactgtaacggagatt
gtggcgattttaatcgaagcacagcaaaaaggagaagatgtcaacttgaacaagctgaag
tgcgctgtttcggtgaaatacggtttgaagagtcagccaaagctggttgatattatcgct
gcagtgccaatgtcgcacagagagttgcttttgcccaaactgaaagcgaagccgaaaaac
gagaacagtaataacagctgcgaagttgtaattgtgtttgcgcaggttcgaacagcaagc
ggaattgctatagtagctgtgatgtgcaagcctcatcgttgtccgcatatttacgtaact
ggcaacgtgtgttcctattgtccgggcggtcctgattcagattttgaatattcaacgcaa
agttacaccggatatgaaccgacttcgatgcgagcaattcgagcacggtacgatccattt
ttgcaagccaaaggacgtcttctgcaactgcaacaattgggccattcaatcgacaaagtc
gaatatattgtcatgggcggcactttcatgtctttgcccgacgactacagagattatttc
attcgcaatttgcacgatgcgttgtcgggtcatacgagccgcaacgtggccgaagcagtg
cgttattcggaacgtagcaaagtcaaatgtattggaataacaatagaaactcgtccggat
tattgcttgcaacgccacttgtcgcagatgctttcctacggttgcactcggctagaaatt
ggactgcaaagcatctacgagcatgtggctcgggacacgaaccgtgggcatactgtaaag
gcggtatgtgaagcgttccgctatgcaaaagatgcgggatttaaagtagtggctcatatg
atgccaaatttgccaaacgtgagctatgaagaagatttgcatcaatttcgagaacttttc
gaaaatcccgactttcgacctgacggtttgaaaatctacccgactttggtcattcgtgga
actggaatttatgaattgtggaaaagaggcaagtacaaatcgtatccggccgaaacgttg
atcgaattgttggcgaagattttggaaatcgtaccaccctgggtgagggtgtaccgagtg
cagagggatataccgatgccgttggtttccagcggtgtgacttacggcaacttgcgggaa
ttggtgttggcaaggatgaaagagctgggaacgaaatgtcgcgacgttcgcacgcgtgaa
gttggcattcaagagattcacaacaaagtcagaccgaagaacattgaattgatacgacga
gattacgaagccaacggcggtttggaaacgtttctctcttttgaagatcccgagcaggat
attttggtcggcctgctgcgcctgcgcaaaatacccgacgacagtccaaacaagcagcca
gaattggccggataccgttgttcgatggttcgcgaattgcatgtctacggttctgttgtg
ccgataagctctcgcgatccggacaaatttcaacacaaaggttacggtatacagttgatg
aaagaagccgaaagaattgccagagaagagcacaaatccgaaaaactgtctgtcatatct
ggcgtcggcacgagaaattattacagaaaacttggctatgaactcgacggaccttacatg
tcgaaaatgttgacctga

DBGET integrated database retrieval system