KEGG   Trichinella spiralis: Tsp_07157Help
Entry
Tsp_07157         CDS       T01609                                 

Definition
putative eukaryotic translation initiation factor 3 subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tsp  Trichinella spiralis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Tsp_07157
Translation factors [BR:tsp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Tsp_07157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 226 aa AA seqDB search
MAAHESWENEGGMNDMMFSRKDWDENENDENVKENWFDSDEEEEKPPVKQPPQVTKPGKK
KGKKAVKEVSDEEPEKQLSQKELEEIQKKAELAIAQEIFSTADDDMKVNFDSMHPKTEED
FDKLRQMIVNKLHLCEKEAGFNGFMEKLIHDIFINMYREHSDVVRKFSRSLNALASELAK
IEKEKQKPKQKKKAPIAKMSRNSDFFDDIVSGMEGGIEYYEDEDFM
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcatgaatcttgggaaaatgaaggcggaatgaacgatatgatgttttcgaga
aaggattgggatgaaaacgaaaatgatgaaaatgtaaaggaaaactggtttgacagcgat
gaagaagaggaaaagccacccgtaaaacaacctcctcaagttacgaaacctggaaaaaag
aaaggaaaaaaggcagttaaagaagtttcagatgaggaaccagagaaacagttaagccaa
aaggagttggaagaaattcagaagaaagctgaattagccattgctcaagaaatatttagc
actgctgatgatgatatgaaagtcaatttcgattccatgcatccaaaaactgaagaggat
tttgataaacttcgtcaaatgattgtaaataagctacatttatgtgagaaagaagctgga
tttaatggttttatggaaaaattaattcacgatatttttataaacatgtacagagaacat
tcggatgttgtacgaaaattttcacgcagtttgaatgctcttgcgtcagaattagcaaag
atagaaaaagagaagcaaaaaccaaaacaaaaaaagaaggccccaattgcaaagatgagt
cgaaattctgacttttttgatgacatagtgagcggtatggaagggggaatagaatattat
gaagatgaagatttcatgtga

DBGET integrated database retrieval system