KEGG   Trichinella spiralis: Tsp_07501Help
Entry
Tsp_07501         CDS       T01609                                 

Definition
serine/threonine-protein kinase 6
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Tsp_07501
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: Other group
  Aur family [Table]
   Tsp_07501
Protein phosphatases and associated proteins [BR:tsp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tsp_07501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 381 aa AA seqDB search
MAPERCKAYDHKIIEKGIINNKQHKSTERQALMSFLNNKIKKDLTALLYRKSYSNGHCTK
CFSEMAHKTMSRLKRHSKEGEVVPNESNSTEQAEQFKNENKEATSAPKTSKEKEKTRKMW
TLDDFEIGRALGKGKFGHVYLAREKQHKFVVALKVLFKSQLVNAGCEHQLRREIEIQAHL
KHPNILRLYGYFYDSSRIYLILEYAGKGELYAELKRCGHFSEKQSAQYLHQLIGALSYLH
SKKVIHRDIKPENILIGSNGQLKIADFGWSVHSPSSRRGTVCGTLDYLPPEMISGQPHGD
AVDLWSLGVLLFEFLNGKPPFYSESQHATFRRIRQCQYEMPENFSEGAKDVIRRLLQPTP
SKRMPLKELAAHPWILENKDN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggccccagagcgttgcaaggcatacgatcacaaaataatagaaaaaggtatcataaac
aacaaacagcacaaatcaacagaaaggcaagcattgatgtcgtttctgaataataaaata
aaaaaggatttaactgctttgctgtatcggaaatcatattcaaatggacactgcaccaaa
tgcttctcagaaatggcacacaagacaatgagtcggttaaagaggcattctaaagaaggt
gaagttgttccaaatgaatcgaattcaaccgaacaagctgaacagtttaaaaatgaaaat
aaagaagctacgtcagcacctaaaaccagtaaagaaaaggaaaaaactcgaaaaatgtgg
acattggatgattttgaaattggtcgagcacttggaaagggaaaatttggtcatgtatat
ttagctcgagaaaagcagcacaaatttgtcgttgctcttaaagtgctgtttaagtcgcag
ttggtgaatgcaggttgtgaacatcagctgagacgagaaattgaaattcaagctcatttg
aaacatccaaacattctacgtttgtatggctatttttatgactcttctcgtatatactta
attctggaatatgctggtaaaggtgaattgtatgccgagttgaaacgttgtgggcacttt
tcagaaaagcagtcagctcagtatttgcaccaattaattggggctttatcttatttgcac
agtaaaaaggtgattcatcgtgacatcaagccggaaaatattctgattggtagtaatggt
cagttgaagattgctgactttggatggtcggttcattcgccatcgtcgaggcgtggcact
gtttgtggaacgttggattatctgccgcctgaaatgatctctggtcaaccacacggtgat
gcagttgatctttggtctcttggggtgttgttgttcgaatttttgaatggaaagcctcca
ttttattcagaaagtcagcatgccacgtttcgtcgtattcgacagtgtcaatatgaaatg
cctgaaaatttttcagaaggggcgaaagatgtgatccgcaggctgttgcaaccgacgcca
tcaaaacgcatgccattgaaagaattggctgctcatccttggatactcgaaaataaggat
aattaa

DBGET integrated database retrieval system