KEGG   Trichinella spiralis: Tsp_07542Help
Entry
Tsp_07542         CDS       T01609                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 1A
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Tsp_07542
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Tsp_07542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 688 aa AA seqDB search
MRLVMRMTCLKRCCKMVMTQELVIASTAPAVSNSPGMLHYNNSELVFRDRSLAPLKKLSI
DLIKTYQRINEMYYAKKKRRVAQRKAEDELAKRGRDLNNDGYDDENHDYIIRRGDRLLGR
YVIENLIGKGSFGQVVKAMDTVENCHVAIKVIKNKRPFLNQAQIEVQLLRMMNKLDENSK
YYIVKLKTDFMWKSHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLST
PELSIIHCDLKPENILLCNPKRSAIKIIDFGSSCQMGQRIYQYIQSRFYRSPEVLLGIAY
DMAIDMWSLGCILVEMHTGEPLFSGTNEFDQVMKIVEVLGLPPKEILDAAPRTAKYFEKN
PDGSYRCKTARDGRRYEAPGERKLSAILGVYQNGPGGRRVGEPGHNEVDYLKFQDLVLRM
LDYDSKTRVTPYYALQHAFFKKTVDEGTNTAIDRPDTASASTSDEALSSNRAGQQQESAI
DLVIRRQHGTSSTKRDEPHRQSNVDYLLRSDVATTSAGASSASVVGHERWSSGVSHGNSD
GMWPSSSSLRWPASAADDHCQLAPAHSATVSSAAAMSSSSSSSSGKVRRNLQQQQPHLSP
DNGHHVQQQHEQHSYHHPNAPSASTSSSFLNGRGATATTSRHGGGARVVENLAPARGVVR
ASNPSNLSSYGSLSSGCPNFYPFAPGND
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttgtcatgcgtatgacatgcctgaaacgttgttgtaaaatggtgatgacgcaa
gaattggtgatcgcttcgactgctccggcagtgagcaactcccccggcatgttgcattat
aataattcagagttggtgtttcgcgatcgatcgttggcaccgttgaaaaaattgtcaatt
gacttgatcaaaacttaccaacgaataaatgagatgtattatgcgaaaaaaaagcgacgt
gttgcacagcggaaagctgaagacgagctggcaaaacgtggacgcgatttgaacaacgat
ggttatgatgatgaaaatcatgattacattataagacgaggcgatcgtttgctgggccgt
tatgtgatcgaaaatctcattggaaaaggatctttcggtcaagtggtgaaagcgatggac
actgttgaaaactgccacgtagctataaaagtgatcaaaaacaaacggccatttttgaac
caagctcaaatcgaagtccagttgctgaggatgatgaataaactggacgaaaattcgaag
tattacatcgtgaagctgaagacagattttatgtggaaaagtcacttgtgtcttgttttt
gaattgctctcttacaatttatatgatttattgcggaacaccaattttcggggtgtgtcg
ttgaatttgactcgaaaattcgctcaacaattatgtactgcacttttgtttctctccact
ccagagctgagtatcatccactgcgatttgaagccagaaaacatactgctgtgtaatccg
aaacgttcggcaatcaaaatcattgactttggttcatcttgccaaatgggacaaaggatt
taccagtacatacagagtcggttttatcgttcgccggaagttttgctcggtattgcttac
gacatggccattgacatgtggtcgttgggatgcatacttgttgaaatgcataccggtgaa
ccgcttttttcaggcacaaatgaatttgaccaggtgatgaaaattgtcgaagttcttggt
ttgccaccgaaggagatactggatgcggctcctcgaacggcgaaatattttgaaaagaac
cctgacggctcgtatcggtgcaaaactgcacgcgacggtcgtcgttacgaggctccagga
gagaggaagctgtcggcaattttgggcgtttaccagaacggacccggtggcaggcgtgtt
ggtgagccaggtcacaacgaggtggactatttaaaattccaagatcttgtgttgcgcatg
ttggattatgactcgaaaactcgagtaacaccttattacgcgttgcagcatgcttttttc
aaaaaaaccgtcgacgaagggacaaatactgcaatagatcgaccggatactgcttctgcg
tcgacgtcggacgaagcactgagcagcaacagagctggtcaacaacaagagtcggcgatc
gatttggtgattcgtcgacaacacggtacatcgtcgacaaaacgagatgaaccacatcga
cagtctaatgtcgattatttattacgcagtgacgtggcaaccacatctgctggtgcttct
tcggcgtctgttgttggtcacgaacgttggtccagtggcgtcagtcacggaaattctgat
ggcatgtggcccagcagttcatctttgcgatggccagcatcagcagcagatgatcactgc
cagttggcaccagcacacagtgcgacagtttcgtcggctgcagctatgtcgtcgtcgtcg
tcgtcaagcagtgggaaagtgcgaagaaatttacaacagcaacaaccacatctatcaccg
gataatggtcaccacgtacagcaacaacacgagcagcacagttatcaccatccaaatgca
ccatctgcttcgacgtcgtcgtcatttctcaatggtcgaggtgcaacagcaacaactagt
cgtcacggtggtggtgctcgtgtagtcgaaaatctagcccctgctcgtggtgttgtgcgc
gccagcaaccccagcaatttgagcagttatggttcattgtcatccggttgtccgaatttc
tacccttttgcgccgggtaacgattag

DBGET integrated database retrieval system