KEGG   Trichinella spiralis: Tsp_07594Help
Entry
Tsp_07594         CDS       T01609                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tsp  Trichinella spiralis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tsp00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:tsp04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tsp04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 571 aa AA seqDB search
MHKPGKIGYIFSPKQLRSSKKNMQTCKSDFRKEGPSADALDFDEFHHFFRFLTDRPDLRD
IIRQLSEFHEEFFTVEDLKNFLTNIQQLSAITLSHCRQLIRRYEPEPENQKSLKLSFHGL
RRLLLSEAGNIVKPEHKVIYQNMEQPLTNYYIYSTHNTYLCGHQLMGDATIEGYILALKK
GARLLELDIWPGENDLQVTHGHTLVKPVSLSVVLKAINNYGFSTTPYPIILSLEIHCDVR
KQAILADMLVKTFGKKLHKNVAHLKTLPSPEELKNKILLKGKGGLAKELAALIAIVSAKL
VNPLVDLERHPVNSMASKSEDQLIAMVEENQPAMVKYTSQHLVKCYPRGTRTSSTNMNPV
VYWLAGIQSVCLNVQTADLANDLNTAMFSINGNCGYVLKPDCLQNKESSTEQQVKKMIVR
VWIIILSANFLPKPSTTTNKEDVIDPYVKVETFGMPSDRVKYRTAVIRNNGFNPCWNESF
RIDLRYADSAFLRFCIKDYNLRAKDDFIGQCTIPVNSIRPGYSYIHLKTGFYRQEDPAAV
LFMKVCRHCPELDNSNLQSPQQEWPFWPLPQ
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaccaggcaaaattgggtacattttctcaccgaagcaattgagaagctcaaag
aagaacatgcagacttgtaagagtgattttcgaaaagaaggtccatcagcggatgcattg
gattttgacgaatttcatcacttttttcgtttcttaactgatcgtccagatttgagggac
ataatccgtcaattgtccgaatttcacgaggaatttttcaccgttgaagatttgaaaaat
tttctcaccaatattcaacaattatctgcaatcacattgtcacactgccggcaattgatt
agacgttacgagccggaaccagaaaatcaaaaatcgcttaaactttctttccacggtttg
cgtcgattgttactttccgaagctggcaatattgtcaaacctgaacacaaagttatctat
caaaatatggaacagccgttgacaaattattacatctattcaacgcacaatacctatctc
tgtggtcatcaattgatgggcgacgcaacaattgaagggtacattttagctttgaagaaa
ggagctcggctgttggaattagacatttggcctggtgaaaatgatctgcaagttacgcat
ggtcacaccttggtcaagcctgtatcgctcagtgttgtattgaaagcgatcaacaattat
ggcttttctactacaccttatccaattatattatctttggaaattcactgcgatgttcga
aaacaagcaatcttggcagatatgttggtgaaaacattcggcaagaaacttcataaaaat
gttgctcatttgaaaacactgccatcaccggaagaattgaagaataaaatacttttaaaa
ggtaaaggtggtcttgcaaaagaattagcagctctaattgcaattgtttcggctaaactg
gtcaatccattggtggatttagaaagacatccagtaaacagtatggctagcaaatcggaa
gatcaactgattgcaatggttgaagaaaatcaacctgctatggtgaagtatacttctcaa
catttggtgaaatgctacccaagaggaacacgcacatcgtccacaaacatgaatccagta
gtttactggcttgctggaattcaatctgtttgtttgaatgttcagaccgctgatttggca
aatgatttgaacacagctatgttttcaattaatggaaactgtggctacgtattgaaacca
gactgtttgcaaaataaagaatcttccactgagcagcaggtgaaaaagatgattgttcgt
gtatggattattatactttctgctaattttttacccaagccgtcaaccactacaaataaa
gaagatgtaattgatccgtatgtcaaagttgaaacttttggcatgccttcagatagagtg
aaatacagaacagcagtgattcgaaacaatggtttcaatccatgctggaatgaatcattt
cgaattgatttgcgctatgctgattcagcttttctcagattttgcatcaaagactataat
ttaagagcaaaagatgacttcattggccaatgtacaattcctgtgaacagtataagacct
ggttacagttatattcatctgaaaacaggattttacagacaagaagatcccgctgctgtt
ctatttatgaaggtgtgtcgtcattgcccggaattggataattcgaatctacaatcgcca
caacaggaatggccattttggccgcttccacaatag

DBGET integrated database retrieval system