KEGG   Trichinella spiralis: Tsp_07620Help
Entry
Tsp_07620         CDS       T01609                                 

Definition
myosin heavy chain kinase B
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     Tsp_07620
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   Tsp_07620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 662 aa AA seqDB search
MFDMDKKNNAVSINTANDDEMLIYPFHESPPPAKCGEEFAVGQELVARNASEGHLSKNKI
RMKWRQMVKKVLRVPDPWEMLKLNSSPVEQCLRYRYSALRGEWVTDRVFVKIEDEPFDRG
AMRICYRLKKCPGVHEDVPSDWSKATNFVAKRYIAQSVSRETYFEDVRLQMDAKLWSDEF
NRHNPPKKIDIFQVSIVEFVNRPEKPLFHLEHFIEGNYVKYNSNSGFVLSSSVYRQTPQA
FSHFTFEMSAHQLIVVDIQGVGDLYTDPQIHTSDGIGYGDGNLGTKGMALFFYSHACNSI
CRSLNLAEFDLAPAERASRKKSYAIKQHLSETVVRDATQRCRDFCPSSGIRAMDYVRARS
ATSMMAASSGDFTPLSPGHYPDVFNFTESSDETSSSEVNGSSSASALPMEAAATTGRRRI
DSEVDSSSKQDSMRNQYWAGRRGKSLPACIITQQLHLHNSEDNILGRIHLDLARYHELGR
FVEPDTQYDRSAAWFHLEKAAECGVHEAVMTMAKIYLGVEHELLEDFMEDGTTDENINQG
LKLAEKLAINGDRWATLLLAERYASGQLLGSERKQSYKTALFFYNKLLEQVDPKGNVDIA
IYEIHAVIADLYRTGGTDLKKDVNLAVYHYNEAAALATENLKGKLAMKYYTAAEQCAAEE
GE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatggacaagaagaataatgctgtttcaataaatactgctaatgacgacgag
atgctaatttatccatttcacgaatcgccgccgccagcgaagtgtggcgaagaatttgcc
gttggacaagaattggtagcaagaaacgcttcggaagggcatttgtcgaaaaataaaata
cgaatgaaatggcgccaaatggtgaagaaggttctgcgcgtgccggacccttgggaaatg
ttgaagttgaattccagcccagtggaacagtgcctgcgttacaggtattcagcgttgcgt
ggcgaatgggtcaccgatagggtttttgtgaaaattgaagacgaaccgttcgaccggggc
gccatgcgtatatgctatcgtttgaaaaagtgcccgggcgtgcatgaagacgtgcccagc
gattggagcaaagcgacaaattttgtcgccaaacgttacatcgcgcagagcgtctctagg
gagacttattttgaagatgtgcgtctgcaaatggacgccaaactttggagtgacgagttc
aaccgccacaatccgccgaaaaaaatcgacattttccaagtgtcgatagtggaatttgtc
aaccgaccagaaaaaccccttttccacttggaacacttcattgaggggaactacgtgaaa
tacaattccaattctggctttgtcctttcttcgtcggtttaccgtcagacgccacaagca
tttagtcatttcacgtttgaaatgagtgcccatcaattaattgtggtcgacatccaaggt
gttggcgatttgtacaccgacccccagattcacaccagtgacggtattgggtacggtgat
ggcaatttgggaacaaaaggcatggcgttgtttttttattcgcacgcgtgcaattcaatt
tgccgttcgttgaatttggcagaattcgatttggcgccagccgaacgggccagtcgaaaa
aagtcttacgctataaagcagcatttgtcggagacggtggtgcgtgatgcgacccaacgt
tgccgtgatttttgcccctcgtctggaatcagggcaatggattacgtgcgagccaggtcg
gcaacgtcgatgatggccgcgagcagtggtgacttcacaccgctcagccctggacattat
ccggatgttttcaatttcaccgaatcttctgatgaaacgtcgtcatccgaagtgaacggt
tcttcttcggcttcggcactgccaatggaagcggcagcaacaactgggcgccgacgaatt
gactccgaagtcgattcgtccagtaaacaagattcaatgagaaatcagtattgggcaggg
cgacgaggaaaatccctaccggcctgtataattacgcaacagttgcatttgcacaatagt
gaggacaatattctcggccgtatacacttggacttggcccggtatcacgagctcgggaga
tttgttgaaccggatacccagtatgaccgcagtgcagcctggttccacctcgagaaggcg
gctgagtgtggggtgcacgaagctgttatgacgatggcaaaaatttacctcggcgtcgaa
cacgaactgctggaagattttatggaagatggtacgacagatgaaaatattaatcaagga
ttgaaattggccgagaaacttgcaatcaatggagaccgctgggcaacgctgctgttagct
gaacgttatgctagtggccagttgctcggctcggaaagaaaacaaagctacaaaacagcg
ctgttcttctacaataaactgctcgaacaagtggatccgaaaggtaacgtcgacattgcc
atttatgaaatccatgctgtgatagcggacctctaccgaacgggaggaacagatttgaaa
aaagacgtcaatttagctgtgtatcattataacgaagcggcagctttagcaactgaaaat
ttgaaaggaaaacttgccatgaagtattacaccgctgctgaacaatgtgcagctgaagaa
ggtgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system