KEGG   Trichinella spiralis: Tsp_07696Help
Entry
Tsp_07696         CDS       T01609                                 

Definition
histone H2B, gonadal
Orthology
K11252  
histone H2B
Organism
tsp  Trichinella spiralis
Brite
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tsp_07696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 123 aa AA seqDB search
MAPKVPAKGVKKAGKAQKVTKAGDRKRKRSRKESFASYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFDRIAAESSRLAHYNHRSTISSREIQTAVRLLLPGELSKHAVSEGTKAVTKYT
SAK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaaagttcctgcgaaaggcgtaaagaaagctgggaaagcgcaaaaagttacc
aaagctggcgatagaaagcgtaaaagatcccgtaaggaatcatttgctagttacatctat
aaagttttgaaacaagttcatcctgacactggcattagcagtaaagctatgtctataatg
aacagttttgttaatgacatttttgatcgtattgcggctgaatcatcccggttggcgcac
tacaatcaccgcagcacaatcagttctagagaaattcagactgcagtgcgtctgttgttg
cctggagaattgagcaaacatgctgtcagcgaaggcactaaagctgtcacaaaatatacc
agcgcgaaataa

DBGET integrated database retrieval system