KEGG   Trichinella spiralis: Tsp_07883Help
Entry
Tsp_07883         CDS       T01609                                 

Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
tsp  Trichinella spiralis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tsp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1638 aa AA seqDB search
MSSTSCKKLMPRMHSIILYNKLEKIEALLYEIVYEYVMTMDNLTYTLTLEHGLNTESKLY
QVQKGSTIRFVPGSSLFGMDVYFSTTYPESKLNINRYEAVWRQLEWNQGSDNSADDFGRY
IDIKCDIAGPHMFSFCYNPGDVSLHDGIGYFLVLPTLTVGKSKKEIPLHAIQCQTVLAKL
LGPFDEWEQRLRVSKESGYNMVHITPIQELGQSNSSYSIADQLTLNPIFKGKGEEYTLLD
VKRLVQKMNEDWEMLVISDVVWNHTASNSSWLRTEPDCAYNMRNSPHLRPAWLLDRVLAH
FGRLIANGKFEESGLPSKSRWDNENLENLRHMLLNDILPPARFHEFFQVNIDKEVQQFAD
EIAELNKPSNVVLQTEQCLRILQDPDYGRLNCTLDSHALALLLFNRAVDGCSDEKERQRI
CVENFRRAVKELNDNAARDCWNHLHVAVNALIGHVSYQRVQDHGPKYFLYPGKWEASWED
EENMMYTHEGSRFMALNGWVMDDIPLTNFAEPPSMVYFRRELICWGDSVKLRYGMSEADN
PYLWRRMSSYTRKTAEIFHGIRIDNCHSTPIHVAEYMLNEARDARPELYVCAELFTRRED
VDNLFVNRLGIVSLIREAMSAPTPDELGRLVHRYGGEPIGSFMPYPYRPLTSSVAQAFFF
DLTHDNCSPIMSKSVYDVLPTAAIVSSACCAIGSNRGLDELIPYHIHVVSEKRLYCSWAS
EDESTAAKAVADGTVSMETGILKARLALNKLHLYLSTHGFTQLYVDRKTDEVHVIKRQNP
ITCESVVIVARNCFNPAGMASRRALLAPCSLIGDLKTILLEAYVEIGELPPDCRSHPIGP
KSSTESCPLLSDGEQFLTGLKNVHLKMLENLKVFNSSMIERVESISSQNSEVEFTELPAG
AVLAMMVTLKPEAREAVHTLRYELALIGFNGYQPIPSQDMNNFQSSGLVQIFDIQSKLLQ
IMKPLSKILEKLSLVDFSYVLYRCDEEERSEYPDQGAYYVPDYGKLTFCGLQGCISVLKE
AKASNNLGHPICKNIRDGDWLADYIVARLKLNPNTVQLSEWFWEIFAIYKKIPFDLKPSY
FEAIISSVYNMVCKTIVQKMSLFIGRGSDFLKNLAISSLMFCNNCKNALLPEVSHLVEFT
DNCHQYSYPYQKIMPSIAAGLPHFSHGLFRNWGRDTFIALPGILLITGRYDEAKYIILAY
GSCLRHGLIPNLVGEGNFARYNCRDAVWWWLLAIRCYCELKKDFSILTQPVRRLFPSTET
GFSTVPIEQPLRETMQEALEAHFYGTNFREENAGPQIDEHMRDEGFNVEIGVDKSTGFVY
GGNAWNCGTWMDKMGSSDLAINRGVPATPRDGSAVELIGLSYAVISWLSSAHQLKAYPFN
GVRKRKSNVWTWENWKIMLIENFERHFWIPMQDCPNDNLVELDLDLVNVRGIYKDSYKAS
NRWADYQFRPNFLITMTLAPDLFKVGNALCALKQVEELLLGPLGMKTLTTRDMAYNGNYD
NSDSSADYRRANGFNYHNGPEWVWIFGYFLRAKMTFAYLKNKQTSGVLDEAVSSVKKLLG
PHWEHLQKSPWFSLPELTNANGSFCRDSCEAQAWSIGSLLQCWRRCRKSGLFLKARLRFF
RNSVAYEKLKLSILLMRR
NT seq 4917 nt NT seq  +upstreamnt  +downstreamnt
atgagttccactagttgcaagaaattgatgcccagaatgcattccattatattgtataat
aaattagaaaaaattgaagctttactttatgaaattgtttatgaatacgttatgaccatg
gacaatttgacgtacactctaactttggaacatggtctgaatacggagtcaaagttatat
caagtccaaaaagggtcgacaattcggtttgttcctggttcaagtttatttggaatggat
gtgtattttagtacaacttatccagaatcaaaactgaatataaataggtatgaagcggtt
tggcgacagctagaatggaatcaaggaagtgacaattctgctgatgactttggccgttac
atagatatcaaatgtgacatagctggaccgcacatgttttcgttttgttataacccagga
gatgtatcactgcatgatggaattggttattttttagtactaccaactttaacagttgga
aaatctaaaaaggaaattcctctgcatgccattcaatgtcaaacagtgttggccaaattg
ctcggaccattcgatgaatgggagcaacgtttacgagtgtccaaagaaagcggttataac
atggttcacataacgccgattcaagaacttggtcaatcgaacagttcatacagtattgct
gaccaactgactttgaatccaatattcaaagggaaaggagaagaatatacactgctagat
gtgaagcggttggttcaaaaaatgaatgaagattgggaaatgctggtcatctcggatgta
gtgtggaatcacacggcgagcaacagcagttggcttaggactgaaccggactgtgcgtac
aacatgagaaattcgcctcatctgcgtccggcttggcttttggatcgagtattggcacat
tttggtcgtcttattgcaaacgggaaattcgaagaatctggattgccttcgaaatcgaga
tgggacaatgaaaatttggagaatttacgtcacatgcttttaaatgatattttaccccca
gcacgttttcatgaatttttccaagttaacattgacaaagaggtgcagcagtttgccgat
gagatagcagaattgaacaagccaagcaatgttgttctacaaacggagcagtgtttgcga
attttacaagatccagattacggaagattgaattgtacattggatagccatgcattggcg
ttgttgctgttcaatcgagcagttgatggatgcagtgatgaaaaggaacgccagcgtatt
tgtgtggaaaattttcgccgagctgttaaagaattgaacgacaatgcggctcgagattgt
tggaatcatttgcatgttgcagtgaacgcgctcatcggtcacgtgtcttatcagagggtt
caagatcatgggcccaagtattttctgtatcccggaaaatgggaagcaagttgggaagac
gaagagaatatgatgtatacgcacgaaggctcccgttttatggctttgaacggatgggtg
atggacgatattccgttaactaactttgccgaacctccttcaatggtttacttccgacga
gagttgatttgttggggtgacagtgtgaaactgcgttacggaatgtcggaagcggataat
ccatacttgtggcgtagaatgtcgtcgtacactcgtaaaactgcggaaattttccacggt
attcgcattgacaattgtcacagtactcctatacacgtggcggagtatatgctgaatgaa
gctcgagacgcgcgaccggaattgtatgtttgtgcggaattgttcacgcgcagagaggat
gtggataatttgtttgtcaatcggttgggaattgtgtctttgattcgcgaagcgatgagt
gcaccgacacccgatgagctcggccgtctggtccatcgatacggtggtgagccgattggt
tctttcatgccgtatccttaccgtccgttgacaagctcagtagctcaggcgttctttttc
gatttaactcacgacaattgttcaccaataatgtcgaagagcgtttacgacgtgttgcct
actgcggcgatcgtatcatccgcttgttgtgctattggtagcaaccgtggtttggacgaa
ttgattccttatcatattcacgtggtaagcgagaaacgtttgtattgttcatgggcaagt
gaagatgaaagcacagctgcaaaggccgttgccgatggtacggtaagcatggagactgga
attttgaaagctcgcctagcgttgaacaagcttcacttgtacctgagcacgcacggcttc
actcaactgtacgttgatcgtaaaaccgacgaagtgcacgtgatcaaacgtcaaaatcca
atcacctgtgaaagtgtggtgatcgtggccaggaattgtttcaaccctgccggtatggcc
agtaggcgtgcccttctagcaccgtgcagtttgatcggcgatctgaagactattctgttg
gaagcttatgtcgaaatcggtgaattgccgccggattgtcgttcccatccaattggaccg
aaatccagcaccgaatcttgccccctgttgtcggatggggaacaatttttgaccggtctc
aaaaatgtccacctgaaaatgcttgaaaatttgaaagttttcaactcgtccatgatcgaa
cgggtggagtcgatttcgtctcagaattctgaagtggaatttaccgaattgccagccggt
gcggttttggcgatgatggtcactttgaaaccggaagcacgagaagctgttcacactcta
cgctacgagctggctctcattggcttcaacggctaccagccgattccatcacaagacatg
aataatttccaatcatcaggtctggtgcagatttttgatattcaaagcaaattgttgcaa
atcatgaagccattgtccaaaattttggagaaactttcgctcgtcgatttcagttatgtg
ctttatcgttgcgatgaagaagaacgcagcgaatatccagatcaaggcgcctactatgtt
cccgattatggaaagcttactttttgcggactgcaaggttgtatcagcgttttgaaagaa
gctaaagcgtcgaacaatttgggacatcccatatgcaaaaacattcgtgatggcgattgg
ttggccgactacattgtagcacgtttgaaactcaatccaaatacagtgcagctgtccgaa
tggttttgggaaatttttgcaatctataagaaaattccattcgacttgaaaccgtcgtat
tttgaagcgatcatcagcagtgtttacaatatggtttgcaaaacgattgtacaaaaaatg
agcctattcattggcagaggcagtgattttttgaaaaatcttgcaattagttcgttgatg
ttttgcaacaattgcaaaaatgctcttttgccggaggtgtcacatctggtcgagtttact
gataactgtcatcaatattcatatccatatcagaaaattatgccctccattgctgcaggt
ttgccgcatttttcgcacggattgtttcgcaactggggtcgagatacgtttattgcactt
ccaggtattttgcttataaccggtcgatacgacgaagcaaagtacattattttggcttat
ggaagttgtttacgtcatggtcttattccaaaccttgtcggcgaagggaactttgcacga
tacaattgtcgtgatgcagtctggtggtggcttttggcaataagatgctattgcgagttg
aaaaaggacttttcaattttgacacaacctgtacgacgattatttccaagcacagagaca
ggattttcaactgtgccaattgaacaacccttacgagagacaatgcaagaggcgttggaa
gctcatttttatggaacaaattttcgagaagagaacgctgggccgcagattgatgaacat
atgcgtgacgagggtttcaatgtagaaattggtgttgacaaatcgaccggctttgtttac
ggcggtaacgcttggaattgtggaacttggatggacaagatgggaagcagcgatttggct
attaaccgtggagtgccggcaaccccgagagacggatctgcagtagaattgataggactg
agctatgctgttattagttggcttagttctgctcaccaattgaaagcatatccctttaat
ggtgtacgaaagaggaaaagcaacgtatggacgtgggaaaattggaaaattatgctgatt
gaaaatttcgaacggcacttttggattccaatgcaagattgtccaaacgacaatctagta
gaattggatttagatttggtcaacgtgcgcggtatatacaaggacagttataaggcgtcc
aatcgatgggcagattatcagttcagaccgaattttttgattaccatgacattggcccca
gatttgtttaaagttggcaatgctttgtgcgctttgaaacaggtagaagagttgcttctt
ggtccattaggaatgaagacgctgactactagagatatggcatacaacggtaattacgac
aatagtgattcttcagcagattatcgtcgtgcgaatggatttaactatcacaatggaccg
gaatgggtgtggatttttggatatttcttgcgagcgaagatgacatttgcctatttgaaa
aacaaacagaccagcggtgttttggacgaggctgtgtccagtgtgaagaagttgcttgga
ccgcattgggagcatttacaaaaaagtccttggttttctttgcctgaattaacgaacgcg
aatggttcattttgtcgagattcatgcgaagctcaagcttggtctattggttctttgttg
cagtgttggcgtcgttgtcgaaaaagtggtttatttttaaaagcacgcttacgtttcttt
cgtaattcagttgcttatgaaaaattgaaattgtcaattttattgatgagaagatga

DBGET integrated database retrieval system