KEGG   Trichinella spiralis: Tsp_08267Help
Entry
Tsp_08267         CDS       T01609                                 

Definition
ubiquitin carboxyl- hydrolase BAP1
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 417 aa AA seqDB search
MQKHLEEESWAELESDPGLFTLLIEDFGVSGLAVEEIYDLQSPLNSRTYGFIFLFKWLGE
HRRGRRELWDFNAKSENNVLNHRLFFAKQKVSNSCATYALLNILLNLNDITIGPLLKNIK
ELTKGLDPESSGVIVANTSELARCHNKHARPDAVRELKKQANRPVRRSVVYSSSKQDRFH
FSSYIQFDGHLYELDSLKDFPIDLGEISANTPWTDYFQKIVLERFSNSNVHSNEIRYNLM
AVIPCPIVEAEEKLGILKANVQILTQILEKFVGSKLRTDKKLGVEERRRRLLLFCESSFK
STKCTDSKCSCFSMPNGISSIEQLLSQSVVNDWFFHRNRKFINLKLTVSSAQVVVFKICV
TKLIALLNYVESEIGQVKMEINALKERKEQFLVDDARRVHDYEPFIRTFLTAMAEKK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaacatttggaagaggaatcttgggcagaattggaaagcgatccaggtttattt
actctgctcattgaagattttggtgttagcggactggcagtggaagaaatatacgacttg
caatcgccattgaacagccgaacctatgggtttatatttttgttcaaatggttgggggaa
catcgtagggggcgacgcgaactttgggacttcaatgcaaagtcagaaaataatgtactg
aatcatcgactattttttgcaaagcagaaagtatcaaattcttgtgccacgtatgctttg
ttgaatattttgttaaacttaaatgatataactattggtccactgttgaagaatataaag
gaattgacgaaaggcttagatccagaaagtagtggtgtaatagtcgcaaatacctctgaa
ctggcacgttgtcacaacaagcacgctagaccagacgctgtgagagagttgaagaagcaa
gcgaaccggccagtgcgtagatccgtagtatattcttcatctaagcaggacagatttcat
ttttccagttatattcaatttgatggtcatttgtacgaattggacagcttgaaagatttt
ccaattgatcttggcgagatatcagcaaacactccatggacagattactttcagaagata
gttttggaacgattttcaaattcgaatgtacattcgaatgaaattcggtacaacttgatg
gcagtgatcccttgtccaattgtggaagcagaagaaaagctgggcatcttgaaagctaac
gtgcaaatattgacgcagattctggaaaagtttgtcggttcgaaactgaggacagataaa
aaattaggcgtggaagaacgccgccgtcggctgctgttgttctgtgaatcatcatttaaa
tcaacaaaatgcaccgattcaaaatgctcatgtttttcaatgccaaatggaattagcagc
attgagcagcttctgtctcaatctgttgtcaacgattggttttttcatcggaatagaaag
tttatcaatttgaaattaacggtatcatcagctcaagtggttgtattcaaaatttgcgtt
actaaactgatcgccctattgaactacgtcgaatcggagattggacaggtgaaaatggaa
attaatgcattgaaagaacgaaaagaacaatttcttgtcgatgatgctcgtcgagtgcac
gattatgaaccgttcataagaacatttctaactgccatggcagaaaaaaaataa

DBGET integrated database retrieval system