KEGG   Trichinella spiralis: Tsp_08277Help
Entry
Tsp_08277         CDS       T01609                                 

Definition
(RefSeq) protein son of sevenless
  KO
K03099  
son of sevenless
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Tsp_08277
   04012 ErbB signaling pathway
    Tsp_08277
   04068 FoxO signaling pathway
    Tsp_08277
   04150 mTOR signaling pathway
    Tsp_08277
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Tsp_08277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 930 aa AA seqDB search
MDENESPSLHSKLSLLPQSSWFGLFTEALYRITQEVNPGFGIQREALDHVESLIIRLMYD
IAAKKPFTISDVEQHIEKTFPAPLNVWAVKEAQDVLGKSSRRHRDRSAVLPFQRIHLMLR
LTGNYVKNIRHSEITLQDLKVAMRADNVLMDLFYHDSEDIPIISLNADDLVSKKVGSLSY
EQTVKDLVHNEAQFLRDVNMIILVFRRALFEAIGDRSGELDAIFSNISEIQEFTSKFLGF
LEDTVEMCREPEIPFVGNCFLEMAEGAEFEVYEKYVKDILNPSCLRTLNVVLQKPTTIVY
LNNINVWFFETQSQGNGFRLAVKYLLPKLLLGPVFHCLKYFEYLPVLIKLSACENDKYDL
VQTESLLMLLKSRLEQKCSSLLKKKKMANQFDLRFIPGGSGRSALMKLQELQRNVDGWDL
KSVGCSCVEFILEGKLRKCGLFGQKLGNTLLSAAAELKYAFEIRQRDSQSSIVLLAADPD
EKCTWLAALLMLQTRSMLERMLDSHLEAEHKRIPLLVPSPEEYRFSEPDSEDNIVLEDYT
SSSGIPVLLIERFDIPDPSAGTMAAALLSETENKSNMDVSEFDSLLRESLKRLRKEYIQP
VRIRVLNIIRQWIDHHWYDFDQDAELLANLKHFLKRIETVHTVVKWTRSLQNIIDRKLHP
IEIARQITLLEFDLYRAVKPIELVGAAWTKKDKDKRSPQLLKLIQHSTKFTYWLEKCVVE
CGNLNERVAVMNRILEIMCIFQELNNFTGLIEIYGVLESSAIHRLYHTWERLDPKLLKVF
EEVKQILSDAHHKLIRERLRSINPPCVPFFGMYLTNIIFLEEGNPIFLKMPLSSQSSEAD
STTHDCEKPTLISFAKCRKIADIITEIQMYQNQPYCLILEPSMRKKVYFFLFILLQHIQN
VKSNIALLIAAASRLCRRQVVTETDERIEN
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaatgaatctccgtcgctgcactctaaactttctcttttgccccagagcagc
tggtttggcctttttaccgaagcactttaccgaatcacacaggaggtgaatcctggtttt
ggaattcaacgcgaagctcttgatcacgttgaaagtttgataatacggctgatgtatgat
attgctgctaaaaagccgttcactatcagtgacgttgagcagcatattgagaaaactttt
ccggctcccttgaatgtttgggcagttaaagaagcacaagatgtgcttggaaaaagcagc
cgtcgtcaccgagatcgttctgctgtacttccttttcaaaggattcacctcatgcttagg
ttgacgggtaactatgtgaaaaatattcgccatagtgaaataacgctgcaagatttgaaa
gttgccatgagggcagacaatgttctcatggatttgttttatcacgattctgaagatatc
cccataatttcattgaatgcagacgatttagtttctaaaaaagttggttctctcagttat
gaacaaacagtaaaagatcttgttcataacgaagctcagtttttgcgagacgtgaatatg
ataatcttagtttttcgaagagctttattcgaagcaataggggatcgttctggagaatta
gatgctatatttagtaatatttctgaaattcaagaatttactagtaaatttcttggattt
ttggaagacacggtagaaatgtgcagagaaccagaaataccgtttgttggaaactgtttc
ttagaaatggctgagggtgctgaatttgaggtgtatgaaaaatatgtaaaagatatttta
aatccgtcttgccttaggacattgaatgtcgtgcttcagaaaccgaccacgattgtgtat
ttaaataatattaatgtttggttttttgaaacgcagtctcagggaaatggatttcgactt
gctgtgaaatatctcttgccaaaattattgctgggtccagtttttcactgccttaaatat
tttgaatacttaccggtgcttattaagttaagtgcttgtgaaaacgacaagtatgatttg
gttcaaacagaaagtttgttgatgctgcttaaaagtcgattggagcaaaagtgctcttca
ttgttgaagaagaagaagatggccaatcagtttgatctgagatttattcccggtggatct
gggagatccgcgctaatgaagcttcaagaattgcaacgaaatgttgatggatgggatttg
aaatcagttggttgcagttgtgtggaattcattcttgaaggaaaattaagaaagtgtggc
ttgttcgggcagaaacttggcaacactttgctcagtgccgctgcagaattgaagtacgcg
tttgagatacgtcagcgggatagtcaaagttcaatcgtgctgctggcagccgatccggac
gaaaagtgcacctggctggcggcgttgttgatgcttcagacgagaagcatgctcgaacgg
atgctcgactcgcatctcgaagctgaacacaagcgcataccgttacttgtaccgtcgccc
gaggaatatcgtttttctgaaccggatagtgaagataatattgttttagaagattacacg
tcaagtagcggtattccagttctgcttattgaacgttttgatataccggatccgtcggcc
ggtactatggcagcagctttgctatctgaaacggaaaataaatcaaacatggacgtgagt
gaatttgacagtctgctcagggaaagtttgaaacgtttgagaaaagaatacattcaacca
gtgcgtatacgcgttttgaatattattcgacaatggattgaccatcattggtatgatttt
gatcaagatgctgaattgttggccaatttgaaacactttttgaaacgcattgaaactgtc
cacactgtagtgaagtggacacgttcattgcaaaatattattgatagaaaacttcatccg
attgaaatagctagacaaattacactgctcgaatttgacctgtacagagcggtgaagccg
attgaattggtcggtgcggcttggacgaaaaaggacaaagacaaacgcagtccccaactt
ctcaaacttattcaacattccacaaagtttacctactggcttgaaaagtgcgttgtcgaa
tgtggaaatttgaacgaacgtgtggcggtgatgaatcgtatattggaaattatgtgcata
tttcaagaattgaacaatttcaccggtttgattgaaatatacggcgttcttgaatcgtcg
gcaattcatcgtctctaccacacttgggagcgtcttgatccgaaattgttgaaagtattt
gaagaggtgaagcagattttgtccgatgctcatcacaagctcatccgtgaacgtttgcgt
tcaatcaatccaccctgtgttccattttttggcatgtatttgacgaatattatttttctc
gaagaaggcaatccgatatttttgaaaatgcccctctccagtcaaagcagtgaagccgat
tcgaccactcacgattgcgagaagccgacgttgattagctttgcaaaatgtcgcaaaatt
gccgacatcatcactgaaattcaaatgtatcaaaatcagccgtactgtctaattttggaa
ccatcaatgcggaaaaaagtttatttttttttgtttattcttcttcaacatattcaaaat
gtgaaaagcaatatcgcattgcttattgctgctgcttcgaggctttgtcgccgtcaagta
gtgacagaaacagatgagagaattgaaaattaa

DBGET integrated database retrieval system