KEGG   Trichinella spiralis: Tsp_08277Help
Entry
Tsp_08277         CDS       T01609                                 

Definition
protein son of sevenless
Orthology
K03099  
son of sevenless
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Tsp_08277
   04012 ErbB signaling pathway
    Tsp_08277
   04630 Jak-STAT signaling pathway
    Tsp_08277
   04068 FoxO signaling pathway
    Tsp_08277
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Tsp_08277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 930 aa AA seqDB search
MDENESPSLHSKLSLLPQSSWFGLFTEALYRITQEVNPGFGIQREALDHVESLIIRLMYD
IAAKKPFTISDVEQHIEKTFPAPLNVWAVKEAQDVLGKSSRRHRDRSAVLPFQRIHLMLR
LTGNYVKNIRHSEITLQDLKVAMRADNVLMDLFYHDSEDIPIISLNADDLVSKKVGSLSY
EQTVKDLVHNEAQFLRDVNMIILVFRRALFEAIGDRSGELDAIFSNISEIQEFTSKFLGF
LEDTVEMCREPEIPFVGNCFLEMAEGAEFEVYEKYVKDILNPSCLRTLNVVLQKPTTIVY
LNNINVWFFETQSQGNGFRLAVKYLLPKLLLGPVFHCLKYFEYLPVLIKLSACENDKYDL
VQTESLLMLLKSRLEQKCSSLLKKKKMANQFDLRFIPGGSGRSALMKLQELQRNVDGWDL
KSVGCSCVEFILEGKLRKCGLFGQKLGNTLLSAAAELKYAFEIRQRDSQSSIVLLAADPD
EKCTWLAALLMLQTRSMLERMLDSHLEAEHKRIPLLVPSPEEYRFSEPDSEDNIVLEDYT
SSSGIPVLLIERFDIPDPSAGTMAAALLSETENKSNMDVSEFDSLLRESLKRLRKEYIQP
VRIRVLNIIRQWIDHHWYDFDQDAELLANLKHFLKRIETVHTVVKWTRSLQNIIDRKLHP
IEIARQITLLEFDLYRAVKPIELVGAAWTKKDKDKRSPQLLKLIQHSTKFTYWLEKCVVE
CGNLNERVAVMNRILEIMCIFQELNNFTGLIEIYGVLESSAIHRLYHTWERLDPKLLKVF
EEVKQILSDAHHKLIRERLRSINPPCVPFFGMYLTNIIFLEEGNPIFLKMPLSSQSSEAD
STTHDCEKPTLISFAKCRKIADIITEIQMYQNQPYCLILEPSMRKKVYFFLFILLQHIQN
VKSNIALLIAAASRLCRRQVVTETDERIEN
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaatgaatctccgtcgctgcactctaaactttctcttttgccccagagcagc
tggtttggcctttttaccgaagcactttaccgaatcacacaggaggtgaatcctggtttt
ggaattcaacgcgaagctcttgatcacgttgaaagtttgataatacggctgatgtatgat
attgctgctaaaaagccgttcactatcagtgacgttgagcagcatattgagaaaactttt
ccggctcccttgaatgtttgggcagttaaagaagcacaagatgtgcttggaaaaagcagc
cgtcgtcaccgagatcgttctgctgtacttccttttcaaaggattcacctcatgcttagg
ttgacgggtaactatgtgaaaaatattcgccatagtgaaataacgctgcaagatttgaaa
gttgccatgagggcagacaatgttctcatggatttgttttatcacgattctgaagatatc
cccataatttcattgaatgcagacgatttagtttctaaaaaagttggttctctcagttat
gaacaaacagtaaaagatcttgttcataacgaagctcagtttttgcgagacgtgaatatg
ataatcttagtttttcgaagagctttattcgaagcaataggggatcgttctggagaatta
gatgctatatttagtaatatttctgaaattcaagaatttactagtaaatttcttggattt
ttggaagacacggtagaaatgtgcagagaaccagaaataccgtttgttggaaactgtttc
ttagaaatggctgagggtgctgaatttgaggtgtatgaaaaatatgtaaaagatatttta
aatccgtcttgccttaggacattgaatgtcgtgcttcagaaaccgaccacgattgtgtat
ttaaataatattaatgtttggttttttgaaacgcagtctcagggaaatggatttcgactt
gctgtgaaatatctcttgccaaaattattgctgggtccagtttttcactgccttaaatat
tttgaatacttaccggtgcttattaagttaagtgcttgtgaaaacgacaagtatgatttg
gttcaaacagaaagtttgttgatgctgcttaaaagtcgattggagcaaaagtgctcttca
ttgttgaagaagaagaagatggccaatcagtttgatctgagatttattcccggtggatct
gggagatccgcgctaatgaagcttcaagaattgcaacgaaatgttgatggatgggatttg
aaatcagttggttgcagttgtgtggaattcattcttgaaggaaaattaagaaagtgtggc
ttgttcgggcagaaacttggcaacactttgctcagtgccgctgcagaattgaagtacgcg
tttgagatacgtcagcgggatagtcaaagttcaatcgtgctgctggcagccgatccggac
gaaaagtgcacctggctggcggcgttgttgatgcttcagacgagaagcatgctcgaacgg
atgctcgactcgcatctcgaagctgaacacaagcgcataccgttacttgtaccgtcgccc
gaggaatatcgtttttctgaaccggatagtgaagataatattgttttagaagattacacg
tcaagtagcggtattccagttctgcttattgaacgttttgatataccggatccgtcggcc
ggtactatggcagcagctttgctatctgaaacggaaaataaatcaaacatggacgtgagt
gaatttgacagtctgctcagggaaagtttgaaacgtttgagaaaagaatacattcaacca
gtgcgtatacgcgttttgaatattattcgacaatggattgaccatcattggtatgatttt
gatcaagatgctgaattgttggccaatttgaaacactttttgaaacgcattgaaactgtc
cacactgtagtgaagtggacacgttcattgcaaaatattattgatagaaaacttcatccg
attgaaatagctagacaaattacactgctcgaatttgacctgtacagagcggtgaagccg
attgaattggtcggtgcggcttggacgaaaaaggacaaagacaaacgcagtccccaactt
ctcaaacttattcaacattccacaaagtttacctactggcttgaaaagtgcgttgtcgaa
tgtggaaatttgaacgaacgtgtggcggtgatgaatcgtatattggaaattatgtgcata
tttcaagaattgaacaatttcaccggtttgattgaaatatacggcgttcttgaatcgtcg
gcaattcatcgtctctaccacacttgggagcgtcttgatccgaaattgttgaaagtattt
gaagaggtgaagcagattttgtccgatgctcatcacaagctcatccgtgaacgtttgcgt
tcaatcaatccaccctgtgttccattttttggcatgtatttgacgaatattatttttctc
gaagaaggcaatccgatatttttgaaaatgcccctctccagtcaaagcagtgaagccgat
tcgaccactcacgattgcgagaagccgacgttgattagctttgcaaaatgtcgcaaaatt
gccgacatcatcactgaaattcaaatgtatcaaaatcagccgtactgtctaattttggaa
ccatcaatgcggaaaaaagtttatttttttttgtttattcttcttcaacatattcaaaat
gtgaaaagcaatatcgcattgcttattgctgctgcttcgaggctttgtcgccgtcaagta
gtgacagaaacagatgagagaattgaaaattaa

DBGET integrated database retrieval system