KEGG   Trichinella spiralis: Tsp_08473Help
Entry
Tsp_08473         CDS       T01609                                 

Definition
putative pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tsp  Trichinella spiralis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tsp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tsp00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tsp00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tsp00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 530 aa AA seqDB search
MLLTLYSDSKIAVAVGEMGLHLNTPASAMYRYARMTGRLTRCFSIFQLEHLSYKCEKHVS
TKWTNIRLLNFSSILPCSQMTSYLIDSLRAVWKYLGSLPSHTKVHMPALSPTMEKGNVVS
WKKKEGEEVAEGDLLCEIETDKATMGFESGEEGYLAKIVIPEGSKDVPVGNLLCVIVENA
DDVAAFSKLSAEELGAQPVGQAPAPAAAAPAAPAAATAAAAPPPPPVTAAAAPAAAPKPP
VQAPPGGRVFASPLAKKMAGEQKIDLQSMKGTGPEGRILAGDLSQPAAAGARMQMVLPAG
GKFTDIELSNMRKTIARRLLESKTSIPHYYLTVEIFVDKILQLRSKLNEELKKENRKISV
NDFIVKASALACKKVPEVNSFWMETFIRRNEFVDVSVAVSTDTGLITPIVFNADSKGILE
ISEEIIALSTRARAGQLKPEEFQGGTFTVSNLGMFGVNHFTAIINPPQSAILAVGTVQKR
VVFDEDKRCAEANVLTVTLSCDHRIIDGAVGAKWLQQLKRYLEKPYTMLL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctattgaccttatatagtgattcaaaaatagctgttgctgttggggaaatgggtttg
catttgaatacaccggcttctgccatgtaccgatacgcacgtatgactggacgattgaca
agatgtttttccatattccaattggaacacctcagttataaatgtgagaagcatgtttct
accaaatggacaaatataaggctgcttaacttctcaagtattttgccctgttcgcagatg
accagctacctaatcgacagtttacgtgctgtatggaaatatttaggctctttaccatcg
catacaaaagtgcacatgccggctctgagtccaactatggaaaaaggcaatgtggtaagt
tggaagaagaaagaaggtgaagaggtggcagaaggggatcttttgtgcgaaattgagacc
gacaaagcgacaatgggattcgaatcgggcgaagagggatatttggcaaaaattgtcatt
cccgaaggttcgaaagatgttccagttggaaatctcttatgcgtcattgtggagaacgct
gatgacgtggcagcatttagcaaactgagtgctgaggagttgggtgctcagccggttggc
caagcaccagcccctgccgctgcagctccggccgccccagccgctgcaacggctgccgcg
gcaccaccaccaccgccagtgaccgctgcagccgctcctgctgctgcaccgaagcctccg
gttcaagctccaccagggggtcgagtgtttgcttcaccattggcgaaaaaaatggctggt
gaacagaaaattgatttacaatcaatgaaaggcaccggacccgaaggacgtatcctggct
ggcgatttgagtcagcctgctgcggccggtgcccgcatgcaaatggttctacctgccgga
ggaaaatttaccgacatcgaactgtccaacatgagaaagaccatagcgagacgtttgctt
gaatccaaaacatcaattccacattactatttaacggtggaaatatttgttgacaaaatt
ctacaactacgcagtaaattgaacgaggaattgaagaaggaaaatcgcaaaatttccgta
aacgatttcatcgtcaaagcatccgctcttgcttgcaagaaggtgccagaagtgaacagc
ttttggatggaaacattcattcgacggaacgaatttgtcgacgttagcgtggcagtcagt
accgatacgggtctgataacaccgatagttttcaatgctgattcaaagggtattttggaa
attagtgaagaaattattgcactttcaactcgtgctagagcaggacagttgaaaccggaa
gagttccaaggtggcacatttacagtctccaatttgggtatgttcggtgtgaatcatttt
acggctataatcaatccgccacagtctgccattcttgctgttggcaccgtacaaaagcga
gtcgtgttcgacgaagacaaaagatgtgcagaagcaaatgttctgacagtgacattgagc
tgtgatcatcgtattatcgacggtgctgtgggcgctaagtggctgcaacaattgaaacgc
tatttagagaagccatacacaatgctgctgtag

DBGET integrated database retrieval system