KEGG   Trichinella spiralis: Tsp_08530Help
Entry
Tsp_08530         CDS       T01609                                 

Definition
putative PHD finger protein
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
tsp  Trichinella spiralis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Tsp_08530
Enzymes [BR:tsp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Tsp_08530
Transcription factors [BR:tsp03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Tsp_08530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1365 aa AA seqDB search
MRGLSLHEVLGSVFGRKEYTLNMVNMNSLNGAHQLIPPVRAPDTVFSQKPGELLWRSELH
TYSNSQKSDNSRPIRSPKVLQKLPFSHLESTTAAKSLPAHIPTVTRLSSDGSAQVAFSDS
TPKAFKAANKSATFAPCRLRTFPDSRAGLPFDSGVLSFPEVGSPSSFNLAEFFPNDNSSL
ISGFCKKLSSSSFGFPRTFPGIGRELKQPTAAEQPAGNVGKVADFFKSNISEPLNKVHQQ
QHQQQQQQQQQQQQQRFTPILGDRFLPLLQMKSSNKMVPKAKPASPLGDLVKRSKCHSEG
NSYANSFKRPADSASDEERQSNIPVKVEKLETVESNNGDVDDGDLGENFFGEFQPRALEK
PIEKPLRRNTISSGKSEPHWEGEDYTTRCFCGMTHNDEFMVQCDKCEVWQHCDCVGLEMS
RIPENYLCELCDPRTLPLSLEEAKLIQMKKLKQRARNRTRKGSGGGGSWGCRGRPKREND
SAELSLDQWLDSLTDTQGAKKILDLLPSESLCKAMFVAVQTHGLVALKKISSGQPIAECI
LKPHLARDKQDILANGVVSSPWLLFQDLKVNGSTGPVDLCVDASDTDFAHLRRSCHPNSQ
IHTVVHNGQLRFVLVAAADISEMVEITIPFDYDYTKSSVPVTCSCFSIHPTLRSKPCLVD
GFKKRAGSKGKLAQQHINDKEENKGKGKLNAASGGGKGCAAAKAGVKKPTQRKAKREKLK
LRWRFDTNLIRRNNVEEKDKSSVDSTTTVKHTGEGNADVDSRDVVGRGVGAADAEAVADD
EAEPVTSSARSKPAAAAAFDEPNQQQQGRQKQRNESKAKRGSIELARLRKDYWYSRQVEE
TSGESGAGGVDWTLPNERTKTSTREERKMQSIMKYIHWMEEQEKKLQRKRGSQQAADRRP
EKKQPRRRSLGDVALLNRTKQVEAAKPDDDRGADSAFDGGDLGESTKVVNILDNLHQPNS
EHAKDSVGELIEKVVEQQADLMSNMNNDKVRHVFQQKTDLQIHREQCTNDNNNNNNDSKL
SIVQQRFPWDKSLLLTAAAAALNSSKTTEEARQKMINIETLNQIGNSGYSRSEFHANAAA
LPKRKLSLDEYKHRKQINEGDVSDNKEHNTPPPPPSPLPPPPSLLEKPKSFFPDMSCKHW
DDMLKSLALHFNNPVGGGVPTLPVERSTLPDLTTPAIPCSLETSDNLNLSANEDQNGTFE
MQTANASNTNFDQNRKDKYQDICNVQLVVLPMKSTGNNEEKKASPSLSEEDHKAVEKNNL
ANIYRQFNEWKKSPMLFIDDVVPAKVSRQEQTCSVDMSLVVNNNDSNGGYSCSVGKKKKA
TGASSTVVSAVVEQCASAAVEGRGGDLDGNFELNEGECIERQRQQ
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggtttgagtctgcatgaagtgcttggtagtgtttttggaaggaaagaatatact
ctgaacatggtgaacatgaactcgttaaatggtgcacatcaattaattcctcctgttaga
gctccggatactgtattttcacaaaaacccggcgaactgttatggagaagtgaacttcac
acttattcaaacagccagaagtcagataattctagaccgattagaagtccaaaggttttg
cagaaattaccttttagtcatttggaatcgacgacggcggcaaaatctttgccggcccac
attccaacagttacacgactgtcatctgacggcagtgctcaggtggcattttcagactcc
acgccgaaggctttcaaagcagctaacaaaagcgccacttttgcgccgtgccgtttgcga
acttttcccgacagtcgcgctggtctgccatttgacagcggtgtgctatcttttcccgaa
gttggcagtccaagtagttttaatttagcagaattttttcccaacgacaacagttcactc
atctccggtttttgtaaaaagctgtcttcgtcatcgtttggctttccacgaacttttccc
ggaattggtcgtgaactgaagcagccaactgctgctgaacagccagcaggaaatgttgga
aaagttgcagattttttcaaatccaatattagcgaacccttgaataaagttcatcaacaa
cagcatcaacaacaacagcaacaacaacagcagcagcagcagcagcgttttacgccaatt
ttgggcgacagattcttaccattgttgcaaatgaagtcgagtaataaaatggtccccaaa
gcgaaacccgcctctcctttgggcgatttggtgaaacggtcgaaatgccacagcgaaggc
aacagttatgcaaatagcttcaaacggccggccgattctgcatcggatgaagagcggcag
tcaaatataccggtgaaagtggaaaagttggaaacggtcgaatcgaacaacggtgacgtt
gatgacggtgatttgggtgaaaattttttcggcgaatttcagccgagggcgttggaaaag
ccgatcgagaagcctttgcgccggaacaccatttcaagcggtaaaagtgaaccccactgg
gaaggcgaagattacacaacgcgctgcttttgcggaatgactcacaacgacgagttcatg
gtccagtgcgacaagtgcgaggtgtggcagcactgcgactgcgtcggtttggaaatgtcc
cgcataccggaaaattatctctgcgagctgtgcgatccgaggacgttgcctttgagtttg
gaagaagcgaaattgatacagatgaagaaattgaagcaacgtgctcggaatcgaactcgc
aaaggtagcggcggcggcgggagctggggctgtcgtgggcgaccgaaaagggaaaacgac
tctgccgaactcagcttggaccagtggctcgattccctcactgatacgcagggtgcgaaa
aagatactggacttgctgccgtctgaaagtttgtgcaaggcgatgttcgtggccgttcag
acgcacggtttggtcgcgttgaagaagatttcgtccggtcaaccgattgccgaatgcatc
ctcaagcctcatttggctcgggataagcaggatattttggccaacggagtggtgtcgtcg
ccgtggcttttgttccaagatttgaaagtgaacggctccactgggccggttgatttgtgc
gtcgacgcttcggacacggattttgcccatttacgtcgatcatgtcatcccaatagtcaa
attcacacggttgttcacaacggacaactgcgttttgtactcgttgctgcggctgacatt
tctgaaatggttgaaattaccataccattcgattacgattataccaagagttcggttcct
gttacgtgtagctgtttttcgattcatccgactttacgttcaaagccttgtctggtggac
ggttttaaaaagcgtgctggctcgaaaggtaaactcgcacagcagcatattaacgacaaa
gaggaaaataagggcaaagggaaattgaacgcagcatccggtggtggcaagggttgtgca
gcggcaaaagccggcgtgaaaaagccgacgcaacgtaaagcgaaaagggaaaaattgaaa
ttgcgttggcgtttcgacacgaatctgattcgtcgaaacaatgttgaagagaaagacaaa
agcagcgtcgacagtacgacaacggtgaaacatacgggcgaaggcaatgccgacgtggac
agtagggatgttgtcggcaggggggtcggtgctgctgatgcggaagcggttgccgacgat
gaagctgaaccggtgacgtcgtcggctcggtcgaagccggcagcagcagcagcattcgac
gagccgaaccagcagcagcagggtcgacaaaagcagagaaatgagtcgaaggcgaaacga
ggtagcatcgagctggcacgtctccgcaaagactactggtattccaggcaggtcgaggag
actagcggcgagtctggtgccggcggggtcgactggactttgccgaacgagaggacgaaa
acgtcgacccgggaagagaggaaaatgcagtcgataatgaagtacatccactggatggaa
gagcaggagaagaagttgcaacggaaacgtggttctcagcaagcggccgaccgtcgaccg
gagaaaaagcaaccgcgtcgtcgaagcttgggtgacgtggcgttgttgaatcgaacaaaa
caagtggaagctgcaaagccggacgacgaccgtggtgcagattctgcatttgacggcggc
gacttgggcgagtcgacgaaagtggtgaacattttggacaatctccaccagccgaactcg
gaacacgcgaaagatagtgttggtgaattgattgaaaaagttgtcgaacagcaagctgat
ctgatgtcgaatatgaacaacgacaaggtgaggcacgttttccagcaaaagaccgacttg
caaattcatcgtgaacaatgtacaaatgataataataataataataatgacagtaaatta
agtattgttcaacaacgatttccgtgggataaaagtttgctgttaacagcagcagcagca
gcgcttaatagtagtaaaacgacagaagaggcacgtcaaaagatgattaatattgaaacg
ttgaatcagattggtaacagtgggtattcgagaagcgaatttcacgccaacgctgctgct
ttaccgaaaaggaagctctctttggacgagtataagcatcgaaagcagatcaacgagggc
gatgtcagtgataacaaagaacacaacacaccaccacccccaccctcaccactaccacca
cccccatcattgttggagaaaccgaaatcattttttccggatatgagctgtaagcattgg
gatgacatgctgaaatcgttggcgttgcatttcaacaacccggttggcggcggcgtaccg
actttgcctgttgaaagatctactcttcctgatttgaccacacctgcaattccttgcagt
ttggaaacatctgataatttgaacttgtcagcgaatgaagatcagaatggcacctttgaa
atgcagacggcgaatgcatcgaacacaaattttgaccaaaacagaaaggacaaatatcag
gatatctgtaatgtgcagttggttgtacttccgatgaaaagtacgggaaataatgaagaa
aaaaaagcttcaccatcgttatcagaagaagatcataaagcggtggaaaagaataatttg
gctaatatttatcgtcagttcaatgaatggaaaaaatcacccatgttgtttattgacgat
gttgttccagcaaaagtttcccgacaagagcagacatgctccgttgatatgagcctagtg
gtgaacaacaacgacagtaacggtggttacagctgcagcgttggcaagaagaaaaaagcg
actggtgcatcttcaacggtggtatctgctgttgtagaacagtgcgcatccgctgctgtt
gagggaagaggaggggatttggatggcaatttcgaattgaacgaaggggaatgcattgaa
cggcagcggcagcagtag

DBGET integrated database retrieval system