KEGG   Trichinella spiralis: Tsp_08849Help
Entry
Tsp_08849         CDS       T01609                                 

Definition
inositol monophosphatase 3
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
tsp  Trichinella spiralis
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Tsp_08849
  Energy metabolism
   00920 Sulfur metabolism
    Tsp_08849
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Tsp_08849
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Tsp_08849
    3.1.3.25  inositol-phosphate phosphatase
     Tsp_08849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 204 aa AA seqDB search
MKVQITDISVWIDPLDGTQELIEGILESVSVMICVAVKGRPVFGVIHRPFTSETIWSVSN
YGCFPDCSMGKNGMDVIDIESSISKIALISRTHSGGAEKILEAALGKSWRIEKAGGSGYK
GLRVLNGSAGLYLHTTTMKKWDVCAVDAIIHSAGGRMTDLTGKNLSYLPSSGETFKTGLL
VTMNEHFYYLSKLLPSLSSIIFMH
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttcaaattactgatatatctgtatggattgatcctttagatggaacacaggaa
ctgatagaaggcatattggaaagtgttagtgttatgatctgcgtcgctgtgaaaggtcgg
cctgtttttggagttattcatcgtccctttacatcggaaactatttggagtgtatccaat
tatggttgttttcctgattgttcaatgggaaagaatggaatggatgtgatcgatatagaa
agcagcataagcaaaattgcgttgatttcgcgcacccattctggaggtgcggagaaaatt
ttagaggctgcacttggaaagtcctggcgtatagaaaaagctggagggtctggctataaa
ggtttgcgcgtcttgaatggctcggcaggattgtatttacatacaacaacaatgaaaaaa
tgggatgtttgtgccgttgatgctattattcactctgcaggtggtcgtatgacagatctt
actggaaagaatttgtcttacttgccctcttcaggcgaaacatttaagactggtctgttg
gtcactatgaatgagcatttctattatctatcaaagcttttgccttcattgtcatcgatt
atatttatgcactaa

DBGET integrated database retrieval system