KEGG   Trichinella spiralis: Tsp_08871Help
Entry
Tsp_08871         CDS       T01609                                 

Definition
(RefSeq) putative UDP-glucuronosyltransferase ugt-58
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tsp  Trichinella spiralis
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tsp_08871
   00053 Ascorbate and aldarate metabolism
    Tsp_08871
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Tsp_08871
   00860 Porphyrin and chlorophyll metabolism
    Tsp_08871
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Tsp_08871
   00982 Drug metabolism - cytochrome P450
    Tsp_08871
   00983 Drug metabolism - other enzymes
    Tsp_08871
Enzymes [BR:tsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Tsp_08871
Glycosyltransferases [BR:tsp01003]
 Others
  Hydrophobic molecule
   Tsp_08871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 682 aa AA seqDB search
MNFEGDLEILSRPTLSVLSHVDMRFIAWSFTFLKTSICQIFAQEYLRWVDFSYRYSCKLE
TLGVKINVPVLKVWNVLKLSFGKLIFIKEKFLPFPKCIYFKGALIMFMHIFTVITECCDG
FVLFYFEKKMLFLENVHCCGKYLLLFVFELILVDICIGGKVLFVPSSIYPSHKMIMHHLA
EELVSRGHQVTFWGINLKKDHLITPKGIEDISWSVDVPESYITNLLLYSNASIYQALWSD
RVTEPARKAANWAMTSRMCDVALQTRKDDFEGREVVKLVKRDFDLVIVDDLYAPCGLLLV
ALRKSVFIYWSMTTMRTETAWSNQSPSPPSYIPVLGTHYTDVMNFVERTHNFLLYLRTLF
IHHRIVLKSVDSVLQKHYPNITEAFYIERNASLNFVNTPALFDFPRPFMPRVVFVGCLQC
RLPKPLPDLFEKFVSEADDENGFLLFTTGFSVPWNVTPHRILRTFVDAFRVLPHRIVWQY
NGKPIKDLSPNVMTSSWVPQQDLLGHPKCRGFITHGGLNSLLESMWHGVPVLGVPMFREH
RDYVLRITARNAGLMLPKSALTKESVSGKIYRLTKDKTYKENALAFKNLLRDVPYTELEL
ATFWVEFIFHHQEVPHARSGADELNLLQYFLVDVIAFLSACLFALTCITWYLLKYTYQAC
GILGQLVCRMVHKRKTSKAKSE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaggcgacttggaaattttgagcagaccaacactttctgtcttgtcacat
gtagacatgcggtttatcgcatggtcgtttacatttttgaaaacgagcatttgtcaaata
tttgcacaagagtatttgcgatgggttgatttttcttatcgttattcatgtaaactagag
acgcttggtgtaaagatcaacgtgccagttctcaaagtgtggaacgttttgaaattgtct
tttggaaaattaattttcatcaaggaaaaatttctaccctttccaaaatgtatctatttc
aagggcgctcttattatgttcatgcatattttcactgttattaccgaatgctgtgatgga
tttgttttattttattttgaaaagaagatgttatttttggaaaatgtgcactgttgtgga
aagtatttgctgttgttcgtatttgaattgatacttgtcgatatctgcattggtggcaag
gtgctgtttgtaccgtcgtcaatttatcccagtcacaagatgatcatgcatcatttggcc
gaagagttggtcagtcgtggtcaccaggtgactttctggggtataaatttgaaaaaagac
catctaatcacaccgaagggaattgaagatatttcttggtcagtcgacgtgccagaatcg
tacattacaaatttactcctatacagcaacgcgtccatttaccaggcgctgtggagtgac
cgcgttacagagccggctcgcaaggcggccaactgggcaatgacctctcgtatgtgtgat
gtcgcgttgcaaacacgaaaagatgattttgaaggaagggaggtggtgaaactggtgaaa
agagattttgatttggtaatagtggatgatctgtacgccccgtgtggattgttgttggtt
gctttgcgcaaatctgttttcatttattggtcgatgacgacgatgcgaacagaaactgcg
tggagcaatcagagtcccagtcctccatcctatattccagtgttgggtacccactatact
gatgtgatgaattttgtagaacgaacgcacaattttttattatacctgagaacgttgttc
attcaccatcgaattgtactgaaatcggttgattcagtgttgcagaagcattatccaaat
ataaccgaagctttttacatcgaacgtaacgctagtttgaattttgttaacacgcctgcg
cttttcgactttcctcggccctttatgccgcgggttgtgttcgtcggatgtttgcaatgc
agattgccaaagccgctgcctgatttgttcgaaaaattcgtgtctgaagcggacgatgaa
aatgggtttttgttgttcactaccggattttcagtgccatggaatgtcactccacaccga
atactgaggacctttgttgacgctttcagagttctccctcatcgaattgtgtggcagtac
aacgggaaaccaattaaagatctttcgccaaacgtgatgacatcatcatgggtaccccaa
caagatcttcttggccatccaaaatgtcgtggcttcattacacacggcggtttgaacagc
ttgttggaaagcatgtggcatggtgtgccagttctgggtgtgccaatgttccgcgaacat
cgcgattacgttttgcggataacggcgcgtaatgccggtctgatgcttcctaaatcagcg
ttgactaaagaatcagtcagcggaaaaatataccgtttgactaaagataaaacgtacaag
gaaaacgcgttggctttcaaaaatttgctgcgcgacgttccatatacagaattggaactt
gcaacattttgggtggagttcatttttcatcatcaagaggttccacatgctcgatctggg
gccgatgagctgaatctgttgcagtattttctggtcgatgtgattgctttcctctcggct
tgcctgtttgcgctaacctgcattacttggtatctgctgaaatatacgtaccaagcgtgc
ggcattttgggtcagcttgtttgtcgaatggtgcacaagcgaaagacgtcgaaagctaaa
tctgaatga

DBGET integrated database retrieval system