KEGG   Trichinella spiralis: Tsp_08871Help
Entry
Tsp_08871         CDS       T01609                                 

Definition
putative UDP-glucuronosyltransferase ugt-58
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tsp  Trichinella spiralis
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tsp_08871
   00053 Ascorbate and aldarate metabolism
    Tsp_08871
   00500 Starch and sucrose metabolism
    Tsp_08871
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Tsp_08871
   00860 Porphyrin and chlorophyll metabolism
    Tsp_08871
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Tsp_08871
   00982 Drug metabolism - cytochrome P450
    Tsp_08871
   00983 Drug metabolism - other enzymes
    Tsp_08871
Enzymes [BR:tsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Tsp_08871
Glycosyltransferases [BR:tsp01003]
 Others
  Hydrophobic molecule
   Tsp_08871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 682 aa AA seqDB search
MNFEGDLEILSRPTLSVLSHVDMRFIAWSFTFLKTSICQIFAQEYLRWVDFSYRYSCKLE
TLGVKINVPVLKVWNVLKLSFGKLIFIKEKFLPFPKCIYFKGALIMFMHIFTVITECCDG
FVLFYFEKKMLFLENVHCCGKYLLLFVFELILVDICIGGKVLFVPSSIYPSHKMIMHHLA
EELVSRGHQVTFWGINLKKDHLITPKGIEDISWSVDVPESYITNLLLYSNASIYQALWSD
RVTEPARKAANWAMTSRMCDVALQTRKDDFEGREVVKLVKRDFDLVIVDDLYAPCGLLLV
ALRKSVFIYWSMTTMRTETAWSNQSPSPPSYIPVLGTHYTDVMNFVERTHNFLLYLRTLF
IHHRIVLKSVDSVLQKHYPNITEAFYIERNASLNFVNTPALFDFPRPFMPRVVFVGCLQC
RLPKPLPDLFEKFVSEADDENGFLLFTTGFSVPWNVTPHRILRTFVDAFRVLPHRIVWQY
NGKPIKDLSPNVMTSSWVPQQDLLGHPKCRGFITHGGLNSLLESMWHGVPVLGVPMFREH
RDYVLRITARNAGLMLPKSALTKESVSGKIYRLTKDKTYKENALAFKNLLRDVPYTELEL
ATFWVEFIFHHQEVPHARSGADELNLLQYFLVDVIAFLSACLFALTCITWYLLKYTYQAC
GILGQLVCRMVHKRKTSKAKSE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaggcgacttggaaattttgagcagaccaacactttctgtcttgtcacat
gtagacatgcggtttatcgcatggtcgtttacatttttgaaaacgagcatttgtcaaata
tttgcacaagagtatttgcgatgggttgatttttcttatcgttattcatgtaaactagag
acgcttggtgtaaagatcaacgtgccagttctcaaagtgtggaacgttttgaaattgtct
tttggaaaattaattttcatcaaggaaaaatttctaccctttccaaaatgtatctatttc
aagggcgctcttattatgttcatgcatattttcactgttattaccgaatgctgtgatgga
tttgttttattttattttgaaaagaagatgttatttttggaaaatgtgcactgttgtgga
aagtatttgctgttgttcgtatttgaattgatacttgtcgatatctgcattggtggcaag
gtgctgtttgtaccgtcgtcaatttatcccagtcacaagatgatcatgcatcatttggcc
gaagagttggtcagtcgtggtcaccaggtgactttctggggtataaatttgaaaaaagac
catctaatcacaccgaagggaattgaagatatttcttggtcagtcgacgtgccagaatcg
tacattacaaatttactcctatacagcaacgcgtccatttaccaggcgctgtggagtgac
cgcgttacagagccggctcgcaaggcggccaactgggcaatgacctctcgtatgtgtgat
gtcgcgttgcaaacacgaaaagatgattttgaaggaagggaggtggtgaaactggtgaaa
agagattttgatttggtaatagtggatgatctgtacgccccgtgtggattgttgttggtt
gctttgcgcaaatctgttttcatttattggtcgatgacgacgatgcgaacagaaactgcg
tggagcaatcagagtcccagtcctccatcctatattccagtgttgggtacccactatact
gatgtgatgaattttgtagaacgaacgcacaattttttattatacctgagaacgttgttc
attcaccatcgaattgtactgaaatcggttgattcagtgttgcagaagcattatccaaat
ataaccgaagctttttacatcgaacgtaacgctagtttgaattttgttaacacgcctgcg
cttttcgactttcctcggccctttatgccgcgggttgtgttcgtcggatgtttgcaatgc
agattgccaaagccgctgcctgatttgttcgaaaaattcgtgtctgaagcggacgatgaa
aatgggtttttgttgttcactaccggattttcagtgccatggaatgtcactccacaccga
atactgaggacctttgttgacgctttcagagttctccctcatcgaattgtgtggcagtac
aacgggaaaccaattaaagatctttcgccaaacgtgatgacatcatcatgggtaccccaa
caagatcttcttggccatccaaaatgtcgtggcttcattacacacggcggtttgaacagc
ttgttggaaagcatgtggcatggtgtgccagttctgggtgtgccaatgttccgcgaacat
cgcgattacgttttgcggataacggcgcgtaatgccggtctgatgcttcctaaatcagcg
ttgactaaagaatcagtcagcggaaaaatataccgtttgactaaagataaaacgtacaag
gaaaacgcgttggctttcaaaaatttgctgcgcgacgttccatatacagaattggaactt
gcaacattttgggtggagttcatttttcatcatcaagaggttccacatgctcgatctggg
gccgatgagctgaatctgttgcagtattttctggtcgatgtgattgctttcctctcggct
tgcctgtttgcgctaacctgcattacttggtatctgctgaaatatacgtaccaagcgtgc
ggcattttgggtcagcttgtttgtcgaatggtgcacaagcgaaagacgtcgaaagctaaa
tctgaatga

DBGET integrated database retrieval system