KEGG   Trichinella spiralis: Tsp_09176Help
Entry
Tsp_09176         CDS       T01609                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-2
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tsp  Trichinella spiralis
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Tsp_09176
   04150 mTOR signaling pathway
    Tsp_09176
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Tsp_09176
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Tsp_09176
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Tsp_09176
Mitochondrial biogenesis [BR:tsp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Tsp_09176
  Mitophagy factors
   Other mitophagy factors
    Tsp_09176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 556 aa AA seqDB search
MVDLLKEKPVVKIYHYILGETLGVGTFGKVKVGVHDVTGHRVAIKILNRQKIKNLDVVGK
IRREIQNLRLFRHPHIIRLYEVISTPTDIFMVMEYVSGGELFDYIVKRGRLQEDDARRFF
QQIISGVDYCHRHMVVHRDLKPENLLLDSENNVKIADFGLSNILTDGEFLRTSCGSPNYA
APEVISGQLYAGPEVDIWSCGIILYAFLCGTLPFDDEHVPSLFRKIKAGQFPIPSYLDDS
VVDLLLRMLQVDPMKRATIKDIVAHEWFKKDLPAYLFPPLNEQEASIVDMDAVRELSEKF
RCDEEEITVALMANDPHNHLVIAYNLILDNKRIATETAKLTMEEFYSPDLPTDRPASIIA
RHPERIDATRTFTPTLESVPNTQPGNGLQVTVSRPLVQSLRRARWHLGIRSQSRPEDIMI
EVLRAMKALDYEWKMINPYHVIVRRRLNPTWPKMSLQLYQVDQKGYLLDFKSLSSDDLLD
CHLAGSCGSCRHRLAASSDRTQSLPNNPAQSSADAEPSTSSAATEQPPSEGAAQPKPPQT
MLFFEMCAALIGSLAR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggtagatctgttgaaagagaaaccggtagtaaaaatttaccactacattcttggtgaa
acgttgggcgttggcacatttggcaaagtgaaagttggcgtgcacgatgtgactggacac
cgggttgcgatcaaaattttgaatcgtcaaaaaattaaaaacttggatgtggttggaaaa
attcgtcgtgaaattcaaaatctgcgactatttcgccacccgcacattattcgtctttat
gaggtgatcagcacgccaaccgacatcttcatggtgatggaatacgtgtccggcggtgaa
ctgttcgactatatagtcaaacgtgggcgcttgcaagaggacgacgctcgtcgctttttc
caacaaattatcagcggcgtggactattgtcatcgtcacatggttgtgcatcgtgatttg
aagccagaaaatttgcttctcgacagtgaaaataatgtcaaaattgccgactttggtctg
tccaacatactgaccgacggtgagtttttgcgcaccagttgcggcagtccaaactacgct
gcaccggaagtgatctctggtcagttgtatgccggtcctgaggtggacatttggtcttgt
ggcataatactgtatgcgttcttgtgtggcacgttgccgttcgacgacgaacacgtgcct
tcgttgttccgtaagatcaaagctggccaatttccaatacccagctatttggatgattcg
gtggtggacttgttgttgcgcatgttgcaagtcgatccgatgaagcgagccactattaag
gatattgttgcgcacgaatggttcaagaaagatttgccagcttacctgtttccaccgttg
aatgaacaagaagcgtccattgtggatatggatgcggtgcgcgagttgagcgaaaagttt
cgctgcgatgaggaagagataacggtcgcattgatggccaacgacccgcacaatcatctg
gttattgcgtacaatttgatcctggacaacaaacgcatcgctacagagacggccaagctg
accatggaagagttctattcgccggatttgccgacagatcgtccagcgtctatcattgcc
agacatccggaacggattgatgctacgcgtacatttacacccacgctggaatcggttccg
aacacccagcctggcaacggtctgcaggtgaccgtatctcgaccgttggtacagtcactg
cgtcgggctcgttggcatttgggtattcgatcgcagagtcgaccagaagacatcatgatt
gaagtgctgcgagcgatgaaagcgttggattacgaatggaagatgatcaatccgtatcac
gttattgttcgacgacgtctgaatccaacctggccgaaaatgagcttgcaactctatcaa
gttgatcagaagggctacttgctagattttaaaagcttgtcttcggacgatttgctggat
tgtcatctggctggaagttgcggcagttgtcgacatcgtctcgccgcatcgtcggatcgt
actcagtcgttgccaaacaatccagcgcagagctctgcggatgcagagccgtcgacgtcg
tctgcggccactgagcaaccaccatccgaaggcgcggctcagccaaaaccgccccagact
atgctatttttcgaaatgtgcgccgcattgatcggctctttggcacgttga

DBGET integrated database retrieval system