KEGG   Trichinella spiralis: Tsp_09221Help
Entry
Tsp_09221         CDS       T01609                                 

Definition
dolichyl-phosphate beta-glucosyltransferase
Orthology
K00729  
dolichyl-phosphate beta-glucosyltransferase [EC:2.4.1.117]
Organism
tsp  Trichinella spiralis
Pathway
N-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Tsp_09221
Enzymes [BR:tsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.117  dolichyl-phosphate beta-glucosyltransferase
     Tsp_09221
Glycosyltransferases [BR:tsp01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   Tsp_09221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 292 aa AA seqDB search
MYVRYEEENFFIDPSDVKKKLKCPSIDDEPSVYLSVIIPAKDEEKRLPKMLDQCIDYLHT
RSVKDPKFTYEIIVVDDGSSDRTAEVTLNYSQKYTVQIVRLLKLRHNRGKGGAVRLGVLC
ARGEKILFADADGATRFSDFTIVETAMEELCQSLGTSKALAVGSRAHLKEESVVKRSVLR
TLLMYGFHLWVWLFCVRTVRDTQCGFKLFTRDAAATLFPQMHMEGWAFDVELLFLAEKLN
IALKEVSVCWTEIEGSKLRPLLAAFQMGRDIFIIWFCYTFNIWHISVKSKIF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtacgatatgaagaagaaaacttcttcatagacccgtcggatgtgaagaaaaaa
ttgaaatgcccatccatagatgatgagccgtctgtatatttgtcagttattattccagcc
aaagatgaagaaaagcgcctacccaaaatgttggatcaatgcattgattatttgcacaca
agaagcgtgaaagatcccaaatttacgtatgaaattattgttgtcgatgacggaagcagt
gatcgcactgcggaagttacactaaactacagtcaaaaatatacagttcagattgttcga
ttgttgaaattgaggcacaaccgtggaaaaggtggcgcagtaaggcttggagttttgtgt
gctcgtggtgagaaaattttgttcgccgacgccgatggcgctacacggttttccgatttt
actatagtcgaaacggccatggaagaactttgccaaagcttgggcacgtcgaaagctctg
gccgttggatcacgagctcatcttaaggaagaatcagttgtaaaacgatctgttttacgt
acattattgatgtatggttttcacttgtgggtttggctgttttgcgttagaactgtacgc
gatacacagtgtggcttcaaattgtttacacgcgatgcagcggcgacactgtttccgcag
atgcacatggaaggttgggcattcgatgttgaattgcttttcttagcggaaaagcttaat
attgctttaaaggaagtttcagtctgctggacagaaattgaaggctccaagctaagacca
ctgttagctgcttttcaaatgggacgagacatattcatcatttggttttgttatacattt
aatatatggcatatttctgtgaagtcgaagattttctga

DBGET integrated database retrieval system