KEGG   Trichinella spiralis: Tsp_09221Help
Entry
Tsp_09221         CDS       T01609                                 

Definition
dolichyl-phosphate beta-glucosyltransferase
Orthology
K00729  
dolichyl-phosphate beta-glucosyltransferase [EC:2.4.1.117]
Organism
tsp  Trichinella spiralis
Pathway
N-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:tsp00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 292 aa AA seqDB search
MYVRYEEENFFIDPSDVKKKLKCPSIDDEPSVYLSVIIPAKDEEKRLPKMLDQCIDYLHT
RSVKDPKFTYEIIVVDDGSSDRTAEVTLNYSQKYTVQIVRLLKLRHNRGKGGAVRLGVLC
ARGEKILFADADGATRFSDFTIVETAMEELCQSLGTSKALAVGSRAHLKEESVVKRSVLR
TLLMYGFHLWVWLFCVRTVRDTQCGFKLFTRDAAATLFPQMHMEGWAFDVELLFLAEKLN
IALKEVSVCWTEIEGSKLRPLLAAFQMGRDIFIIWFCYTFNIWHISVKSKIF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtacgatatgaagaagaaaacttcttcatagacccgtcggatgtgaagaaaaaa
ttgaaatgcccatccatagatgatgagccgtctgtatatttgtcagttattattccagcc
aaagatgaagaaaagcgcctacccaaaatgttggatcaatgcattgattatttgcacaca
agaagcgtgaaagatcccaaatttacgtatgaaattattgttgtcgatgacggaagcagt
gatcgcactgcggaagttacactaaactacagtcaaaaatatacagttcagattgttcga
ttgttgaaattgaggcacaaccgtggaaaaggtggcgcagtaaggcttggagttttgtgt
gctcgtggtgagaaaattttgttcgccgacgccgatggcgctacacggttttccgatttt
actatagtcgaaacggccatggaagaactttgccaaagcttgggcacgtcgaaagctctg
gccgttggatcacgagctcatcttaaggaagaatcagttgtaaaacgatctgttttacgt
acattattgatgtatggttttcacttgtgggtttggctgttttgcgttagaactgtacgc
gatacacagtgtggcttcaaattgtttacacgcgatgcagcggcgacactgtttccgcag
atgcacatggaaggttgggcattcgatgttgaattgcttttcttagcggaaaagcttaat
attgctttaaaggaagtttcagtctgctggacagaaattgaaggctccaagctaagacca
ctgttagctgcttttcaaatgggacgagacatattcatcatttggttttgttatacattt
aatatatggcatatttctgtgaagtcgaagattttctga

DBGET integrated database retrieval system