KEGG   Trichinella spiralis: Tsp_09259Help
Entry
Tsp_09259         CDS       T01609                                 

Definition
ubiquitin carboxyl- hydrolase superfamily
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Tsp_09259
Peptidases [BR:tsp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tsp_09259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 725 aa AA seqDB search
MFLYFENEVQLQYSSNGWKLFPCSVMEKISKKYEEVYNKYFAGSKNGFSENEGKLAAERD
VILCPHIYSSEKICAQEQCRRAGTTENIQSEFLLCLGCGYQFCTDRSFHHALRHFQKAES
HCLTLSLTTLEILCFRCGKFVDTGQSSQLIEVRSLVEKCKKAECSSENSSPHLEKHFAVE
ERNYNITFSKRKMAKNSGISLPVSGLINFGNTCYFNAVLQVLMRTKSFCLLLAKCMSDEN
SQLLDPESVWQYLNAAFSSCPSVYGLEKPHIIAIQFRGNQQHDSHELLRYFLDELRDEEL
VCMKDGIKQCCELTEDEEGKEKLKAYMLCCKTTAVDQVFGGQLLQSIRCLTCNHRSYKLD
PFLDLSLALQNDDCDDNDFQACNTTKAVPMSKHRMKKLKRQKKKEKRGKIRRQRVSSGTG
EQQFLKDSVKNDQMNTVNNVNGDVSSLCEDMNDLTVEDKENCNDDDSGSFYLESDDGGDS
SQFESDDYDELMEKLQPGPKHPVMTSSLKSVDACLNNFMIEELLTGSSKFACDNCAEISG
DKDETKLSDAKKSSLIFSPPAVLTLHLKRFENNGKTNRKIYGHVVFSTELDMSRFCCRKG
RRIFDSRVLYSLYGVICHSGSMYGGHYIAYVKVEDRDDASWKRFLEKVSQVETIIFDPDD
VGWQTKQRRRKTPSGSANHKRSVSDGRRLSRAPTWYMLNDNITSKVPESAVLKAEAYMLF
YERIL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtttctatattttgaaaatgaagtacaactgcagtacagtagtaatggttggaagttg
tttccttgctcagtcatggagaaaatatcaaaaaaatatgaagaagtttacaataagtat
tttgctggttcgaagaacggttttagtgaaaatgaggggaaattagctgccgaacgggac
gttatactctgtccccacatctattcaagcgaaaagatttgcgcgcaggaacagtgtcgc
cgagcagggacaaccgaaaacatccaatctgaatttttactttgtttgggttgtggatac
caattttgcactgatcgttcttttcatcacgctctcagacattttcagaaagcagaatcc
cattgtctaacgttgtctttgactacgctggaaattttatgctttcgctgtggaaaattt
gtagatactggacaaagtagtcagttgattgaagttcgtagccttgtcgaaaagtgtaaa
aaagcagaatgttcatcagaaaatagttctcctcatttggaaaaacattttgctgtagaa
gaaagaaattacaacattactttcagcaagaggaaaatggctaaaaacagtggcatttcg
ttaccagtatcggggttaataaattttggaaatacttgttattttaatgccgttttacaa
gtgctcatgcgtacgaaatcgttttgccttctgttggctaaatgtatgagtgacgagaat
agtcaactgcttgatcctgaatcagtttggcagtacctcaatgcagccttttcatcctgt
ccaagtgtttatggattggaaaagccgcacattatagctattcagtttcggggcaatcag
cagcatgatagtcacgagttgttgcgttactttttggatgaacttcgggatgaagagtta
gtttgcatgaaagatggtattaagcaatgctgcgaattgacagaagacgaagaagggaaa
gagaaattaaaagcttatatgctttgttgcaaaacgacagcagtggatcaagttttcggt
ggccaactgttgcaatctattcggtgtttgacttgtaatcatcgttcttataaattggac
ccatttcttgacttgtcattggctttgcaaaatgacgactgtgatgataatgattttcaa
gcatgcaacacaactaaagctgttcctatgagcaagcatcgaatgaaaaaacttaaaaga
caaaagaaaaaagaaaagcgaggaaagattcgccgacagcgcgtatcatcaggtactggc
gagcagcagtttttaaaagattcagttaaaaatgaccaaatgaatacggtgaataatgtg
aacggtgacgtgagcagtttatgcgaagatatgaacgatttgactgttgaagataaggag
aactgtaacgacgatgattctggatctttttatttggaatccgatgatggtggtgattca
tcgcaattcgaatcggacgattatgatgaattgatggaaaagctccaacctggaccaaaa
catccagttatgacgagttctttgaaatctgtcgacgcatgtttgaacaatttcatgatt
gaagaattgcttacaggcagtagtaaatttgcgtgcgacaattgcgcagaaatatccggt
gacaaagacgagaccaagctttcggatgcgaaaaagtcatcattgattttcagtccacca
gctgtgctgactttgcatttgaaaagattcgaaaacaatggaaagacgaatcgaaaaatt
tatggccacgttgttttctcgacagaattggacatgtcgagattttgttgtcgaaaagga
cgacgtatttttgatagccgtgtactgtattcactttatggtgtgatttgtcacagcggt
tcgatgtacggtggtcactacattgcctacgtgaaggttgaggatcgtgatgatgccagt
tggaaacgatttttagaaaaagtgtcacaagtggaaacgatcatatttgatcctgatgat
gttggctggcaaacaaagcagaggcggcgtaaaacacccagtggatctgcgaatcataag
cgatctgttagcgatggcagacgactgtcacgtgctccaacctggtacatgttgaatgat
aatattacgtcaaaagtgcctgagtctgctgtgctcaaagctgaagcatacatgttgttt
tatgagcgtattctttga

DBGET integrated database retrieval system