KEGG   Trichinella spiralis: Tsp_09297Help
Entry
Tsp_09297         CDS       T01609                                 

Definition
putative protein kinase domain protein
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Tsp_09297
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Tsp_09297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 611 aa AA seqDB search
MENSQLAFDGSCNPTKAHGTAKACLFPPLTFCNGHGEALSMKNLSLTDASETADDLSLSA
VASDAVELPHCLNSCPVGMANISIRKMYEQNPKMYEQYIRKQEPRPGEDRPPSAHFITPQ
QALKFCQNSLVPYEEREIVKYKKIYYVGEDAQKCSTLDSLNNYGNDDANGFYRIVKADHI
AYRYEVIRLLGRGSFGQVIKAFDHRKRTFVALKIIRNQQPFHRQVCSEVNILSLLCRMDE
ENKSNTVRMIDHFTFRNHKCITFELLSISLYDVLRLSKYRGINLKVVRRFAFDILQCLDF
LKRYGIIHCDLKPENIVLRQSDRTGVRVIDFGSSCVKGSRLYSYIQSRFYRAPEVILGCI
YSTPIDMWSFGCILVELFTGNPLFPGVDETDQMALIIEMLGVPPPKLINGRRGSIFFDPD
EWHVTVDINLSVYTVTVVTVYLIVLNQSLPKYCRNMNCSHKSKERGPPGSRSLRDVLKRC
DNGDFIDFVSKCLALDPEERMTPKAALKHSWIRTKQSSSPQQRKAIVEPSDPKPSTDQSN
VTKSTDRRRNNNNNGQENADILLPIPSGQQRCANGIAKNNNSITFRENGIGNILAESAAG
PASGRLKLPFL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattcgcagctcgctttcgatggcagttgcaaccctaccaaagcgcacggtact
gccaaagcctgtctgtttcctccgttgacattttgcaatggccatggtgaagcgttgtcg
atgaaaaatctcagtttgactgatgctagcgaaactgctgacgatctgtccctatcagct
gtagctagcgatgctgtggaacttcctcattgtttgaattcatgcccggtaggaatggcg
aatatttcgataagaaaaatgtacgaacagaatcctaaaatgtatgaacaatacatcagg
aagcaggaaccgagaccaggtgaagatcggccaccgtcggcgcattttataacgcctcag
caagctttgaaattctgccagaatagccttgttccatacgaagagcgagaaattgtcaag
tataaaaagatttattatgtcggtgaagatgcgcaaaagtgttcaacgctggattctttg
aacaactatggcaacgatgatgcgaacggcttttatcgcattgtgaaagcggatcacatt
gcttacagatacgaagtgattcgtcttctgggaagaggcagttttggtcaggtgatcaaa
gctttcgatcatcggaagcgtacgtttgtagctttgaaaatcatccgcaaccaacagcca
tttcatcgtcaagtttgctccgaagtaaatatattaagccttctttgccgtatggatgaa
gaaaataaatcgaacacggttcgcatgatcgaccattttacatttcgaaatcacaaatgc
atcacttttgaattgctcagtatttccttgtatgatgtgcttcgattgagcaaatacaga
ggaatcaatttgaaagttgttcgacgttttgcatttgacattcttcaatgtttggatttt
ttgaaacgctatggaattattcattgcgatctaaagcctgaaaatatagtattacggcag
agcgatcgcactggagtccgagtaatcgattttggcagtagttgtgttaaaggaagccga
ctttattcgtacattcagtccagattctaccgtgctccggaagtgattttgggctgcatt
tatagtacaccgattgatatgtggtcgtttggttgtattttggttgaactctttactgga
aatccacttttcccgggtgtggacgagacagatcaaatggcattgattattgaaatgctc
ggagtgcctccacctaaattaatcaacggaagacgtggttccatattttttgatccagat
gaatggcatgttactgttgatattaatttgtctgtttatactgttactgttgttactgta
tatttaattgtactgaatcagagcttaccgaaatattgtcgaaatatgaattgttctcac
aaaagtaaagagcgaggtcctccgggtagtcgatcgttgcgcgacgttctgaaacgttgt
gacaatggagattttattgattttgtgagtaagtgcctggccttggatcctgaggagcgg
atgacgcccaaggcagctttgaagcattcgtggattcgaaccaaacaaagctcatcaccg
caacaacgcaaagcaatagtggaaccttcggatccaaaaccatcaacagatcaaagtaat
gtgacaaagtccaccgatcgtcgacgtaataataataataatggtcaagagaatgcagat
attttattacccatacccagtggtcagcagagatgcgcaaatggtattgccaaaaataac
aattcaatcactttccgagaaaatggaattggcaacattttagcggaaagtgccgccggt
ccggcatcaggccgtttgaaattgccatttttataa

DBGET integrated database retrieval system