KEGG   Trichinella spiralis: Tsp_09297Help
Entry
Tsp_09297         CDS       T01609                                 

Definition
putative protein kinase domain protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 611 aa AA seqDB search
MENSQLAFDGSCNPTKAHGTAKACLFPPLTFCNGHGEALSMKNLSLTDASETADDLSLSA
VASDAVELPHCLNSCPVGMANISIRKMYEQNPKMYEQYIRKQEPRPGEDRPPSAHFITPQ
QALKFCQNSLVPYEEREIVKYKKIYYVGEDAQKCSTLDSLNNYGNDDANGFYRIVKADHI
AYRYEVIRLLGRGSFGQVIKAFDHRKRTFVALKIIRNQQPFHRQVCSEVNILSLLCRMDE
ENKSNTVRMIDHFTFRNHKCITFELLSISLYDVLRLSKYRGINLKVVRRFAFDILQCLDF
LKRYGIIHCDLKPENIVLRQSDRTGVRVIDFGSSCVKGSRLYSYIQSRFYRAPEVILGCI
YSTPIDMWSFGCILVELFTGNPLFPGVDETDQMALIIEMLGVPPPKLINGRRGSIFFDPD
EWHVTVDINLSVYTVTVVTVYLIVLNQSLPKYCRNMNCSHKSKERGPPGSRSLRDVLKRC
DNGDFIDFVSKCLALDPEERMTPKAALKHSWIRTKQSSSPQQRKAIVEPSDPKPSTDQSN
VTKSTDRRRNNNNNGQENADILLPIPSGQQRCANGIAKNNNSITFRENGIGNILAESAAG
PASGRLKLPFL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattcgcagctcgctttcgatggcagttgcaaccctaccaaagcgcacggtact
gccaaagcctgtctgtttcctccgttgacattttgcaatggccatggtgaagcgttgtcg
atgaaaaatctcagtttgactgatgctagcgaaactgctgacgatctgtccctatcagct
gtagctagcgatgctgtggaacttcctcattgtttgaattcatgcccggtaggaatggcg
aatatttcgataagaaaaatgtacgaacagaatcctaaaatgtatgaacaatacatcagg
aagcaggaaccgagaccaggtgaagatcggccaccgtcggcgcattttataacgcctcag
caagctttgaaattctgccagaatagccttgttccatacgaagagcgagaaattgtcaag
tataaaaagatttattatgtcggtgaagatgcgcaaaagtgttcaacgctggattctttg
aacaactatggcaacgatgatgcgaacggcttttatcgcattgtgaaagcggatcacatt
gcttacagatacgaagtgattcgtcttctgggaagaggcagttttggtcaggtgatcaaa
gctttcgatcatcggaagcgtacgtttgtagctttgaaaatcatccgcaaccaacagcca
tttcatcgtcaagtttgctccgaagtaaatatattaagccttctttgccgtatggatgaa
gaaaataaatcgaacacggttcgcatgatcgaccattttacatttcgaaatcacaaatgc
atcacttttgaattgctcagtatttccttgtatgatgtgcttcgattgagcaaatacaga
ggaatcaatttgaaagttgttcgacgttttgcatttgacattcttcaatgtttggatttt
ttgaaacgctatggaattattcattgcgatctaaagcctgaaaatatagtattacggcag
agcgatcgcactggagtccgagtaatcgattttggcagtagttgtgttaaaggaagccga
ctttattcgtacattcagtccagattctaccgtgctccggaagtgattttgggctgcatt
tatagtacaccgattgatatgtggtcgtttggttgtattttggttgaactctttactgga
aatccacttttcccgggtgtggacgagacagatcaaatggcattgattattgaaatgctc
ggagtgcctccacctaaattaatcaacggaagacgtggttccatattttttgatccagat
gaatggcatgttactgttgatattaatttgtctgtttatactgttactgttgttactgta
tatttaattgtactgaatcagagcttaccgaaatattgtcgaaatatgaattgttctcac
aaaagtaaagagcgaggtcctccgggtagtcgatcgttgcgcgacgttctgaaacgttgt
gacaatggagattttattgattttgtgagtaagtgcctggccttggatcctgaggagcgg
atgacgcccaaggcagctttgaagcattcgtggattcgaaccaaacaaagctcatcaccg
caacaacgcaaagcaatagtggaaccttcggatccaaaaccatcaacagatcaaagtaat
gtgacaaagtccaccgatcgtcgacgtaataataataataatggtcaagagaatgcagat
attttattacccatacccagtggtcagcagagatgcgcaaatggtattgccaaaaataac
aattcaatcactttccgagaaaatggaattggcaacattttagcggaaagtgccgccggt
ccggcatcaggccgtttgaaattgccatttttataa

DBGET integrated database retrieval system