KEGG   Trichinella spiralis: Tsp_09367Help
Entry
Tsp_09367         CDS       T01609                                 

Definition
tRNA pseudouridine synthase A
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 390 aa AA seqDB search
MSSELKFSCSDAINSGTDFELNNQKRQKLENDEETRKIIKAEPTETVRIKRYKYAMFLAY
RGKNYHGMQVNPNVPTVEKYIMEALQKLNLITVDQVVQPSLFKFQRAARTDKGVSATKQI
CSLLLPTIEGKENDTVNLLNGLQRATKSFDSKKWCDYRSYSYTLPSYCFRHQSDLERDKF
RLDNKDIEEINRILMQYVGTHNFYNFTSGKLHKDESCKRFIIRCECGKRFLYNNIEYLTV
DIKGQSFLIHQIRKMIGFCISLIRGDLDPCLQQKVWQNERIKVPKAPSLGLVLEEVRMPH
YEHYNKRFQATHQRLCWDIYQEKCEEFKQAYIIKDILETDESEKIFEEWLTYLTEKFWNE
NDVDDVSIVGHSDNVQTDGKSNLKEKVELS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgaattgaaattcagctgcagcgatgcaataaacagcggcactgattttgaa
ttaaacaatcaaaagcggcaaaagttggagaatgacgaagaaacgaggaaaattataaaa
gcagagccgactgaaactgtgcgaataaaacgttacaaatatgcaatgtttttggcatac
cgaggaaagaattatcacggaatgcaagtaaatcccaatgtacctacagttgaaaaatat
atcatggaagcattgcaaaagttgaatttgatcacggtagatcaggtggtccaaccttcc
ttatttaaatttcaaagagcagctcgtacagataaaggcgtctctgcgaccaagcaaatt
tgttcactgttattaccaacaatagaaggcaaagaaaacgacactgttaatttactgaac
ggtttacaacgtgcaacgaaaagttttgattcaaaaaagtggtgtgactatcgttcatat
tcttatacattaccgtcttattgttttcggcatcaatctgatttggaaagagacaaattt
cgattagacaacaaagacattgaagaaataaatcgaattcttatgcagtatgttggaacg
cataatttttataactttacatctgggaagcttcacaaagacgaaagttgcaaaagattc
ataatacgctgtgaatgcggaaagcgtttcttgtacaataacattgaatatttgacagtt
gatataaaaggccaaagttttttaatacatcagattcgaaaaatgattgggttttgtatt
agtctgattcgtggtgatttggatccgtgtttgcagcaaaaagtttggcaaaatgaaagg
atcaaagttcccaaagccccttctcttggactcgtgctcgaagaggtgagaatgcctcat
tatgaacattacaacaagcgtttccaggcgactcatcagcggctatgttgggatatatat
caggaaaaatgtgaagaatttaaacaggcttatattattaaagatattcttgaaactgat
gaaagtgaaaaaatatttgaagaatggttaacatatttgacagaaaaattttggaatgaa
aatgatgtagacgatgtatcgattgttggtcacagtgataatgtgcaaacagatgggaag
agcaatttgaaagaaaaagttgaactttcctaa

DBGET integrated database retrieval system