KEGG   Trichinella spiralis: Tsp_09483Help
Entry
Tsp_09483         CDS       T01609                                 

Definition
mitogen-activated protein kinase kinase kinase 12
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tsp04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 527 aa AA seqDB search
MEDVAPRSLLDVEELCHLRTQSLPNKLPPPARTSARRATVSCGDGVDYATTAVASSVRRR
STGVVVGAGMKRLDTVGQDGQSPSSGPRLDLWWQGFWGCLRPTAAAPAAAAQTAAAVGSK
SNKQQSAADDWEVPFESITDLQWLGAGSQGAVFLGRFNGESVAVKKLQRIGETNIRHLRH
LSHPNVIKFRGVCTQAPCYCIIMEYCSQGQLYELLRSGKQLSPKLTLDWAKQIASGMHYL
HQQKIIHRDLKSPNVLVTNEDLLKISDFGTSRHWTQANSTRMTFCGTASWMAPEVIRNEP
CSDKVDVWSYGIVLWELLTCEVPYQDVDPTAVMWGVGSHSLQLPIPHSTPEGLQLLLKQC
WSAKPRNRPSFRHILTHLDIAQAELEYFTFEAWISLQQRWKVEIGDRIKTLHRAKDRSCL
QKIIEDQLISRRKDELRHAQDVREMYEQKLRRANNLYSELSQCMMQLEQRERDLLRREQQ
MVAMLSNHGLLSKKPNRIRYRLMRPMMLKGTGDRSVKGSPIGQGYVY
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgtggcaccgcgttcattgttggacgttgaagagctgtgccatttgcggaca
cagtcgttgccgaacaagctaccgccaccggcgcgtacgtcagcgcgccgggcgacggtc
agttgcggcgacggcgtcgactacgcgacgacagccgttgcgagttcggtcagacgtcgg
tcgacgggcgtcgttgtgggcgccggtatgaaacgtctcgacactgtcggtcaggatggc
cagtcgccgtcgtccggtcccaggttggacctctggtggcaagggttctggggctgcttg
cgaccgacggcggcggcgcctgcggccgctgcccaaaccgccgcggcggtgggctcgaaa
agcaacaagcagcagagcgccgccgacgactgggaagtgccgttcgaaagcatcaccgac
ctgcagtggctgggcgcaggctcgcagggcgcggtttttctcggacggttcaacggcgag
tcggtggcggtgaaaaagttgcaacgcatcggcgaaaccaacattcgacacctcagacac
ctctcccacccgaatgtcatcaaattcaggggtgtttgcacacaagctccatgctattgc
attattatggagtattgttcacaggggcaactgtacgaattgttgcgcagcggtaagcag
ttgtcgccgaaattgactttggactgggcaaagcaaattgccagcggtatgcactatttg
caccagcagaaaattatccaccgcgatttgaaatcgcccaacgttctggtgacaaatgaa
gatctgctcaaaatatccgactttggcaccagtcgacattggacccaagcgaacagtaca
cgaatgacattctgcggcactgcgtcttggatggcacctgaggtgatacgcaacgagccg
tgttcggacaaagtcgacgtctggtcgtacggcattgtactctgggagttgctcacctgc
gaggtgccttatcaagacgtggatccgacggccgtgatgtggggcgtcggctcgcacagt
ttgcaattgcccattcctcactcgacccccgaaggattgcaacttttgctcaagcagtgc
tggagcgccaagcctcgaaatcgaccctcctttcgacacatcctcacccatttggacatt
gcccaggctgagttggaatatttcacatttgaagcttggatctcgttgcagcagcgttgg
aaagttgaaattggcgatcgaatcaaaactctgcaccgcgctaaagatcgttcctgtttg
caaaagatcatcgaagatcagctcatcagccgtagaaaggacgaactgagacatgcgcag
gatgttcgcgagatgtacgagcagaaactacgtcgggcgaacaatttgtacagtgaactc
agccagtgcatgatgcagcttgaacagcgagagcgtgatttacttcgacgtgaacagcaa
atggtcgccatgctcagcaatcacggcttactgtcgaaaaagccgaatcgcatccgttac
cgtctcatgcgtccgatgatgttgaaaggtactggcgatcgatcagtcaaaggcagtcca
attgggcaagggtatgtatactga

DBGET integrated database retrieval system