KEGG   Trichinella spiralis: Tsp_09483Help
Entry
Tsp_09483         CDS       T01609                                 

Definition
mitogen-activated protein kinase kinase kinase 12
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Tsp_09483
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     Tsp_09483
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   Tsp_09483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 527 aa AA seqDB search
MEDVAPRSLLDVEELCHLRTQSLPNKLPPPARTSARRATVSCGDGVDYATTAVASSVRRR
STGVVVGAGMKRLDTVGQDGQSPSSGPRLDLWWQGFWGCLRPTAAAPAAAAQTAAAVGSK
SNKQQSAADDWEVPFESITDLQWLGAGSQGAVFLGRFNGESVAVKKLQRIGETNIRHLRH
LSHPNVIKFRGVCTQAPCYCIIMEYCSQGQLYELLRSGKQLSPKLTLDWAKQIASGMHYL
HQQKIIHRDLKSPNVLVTNEDLLKISDFGTSRHWTQANSTRMTFCGTASWMAPEVIRNEP
CSDKVDVWSYGIVLWELLTCEVPYQDVDPTAVMWGVGSHSLQLPIPHSTPEGLQLLLKQC
WSAKPRNRPSFRHILTHLDIAQAELEYFTFEAWISLQQRWKVEIGDRIKTLHRAKDRSCL
QKIIEDQLISRRKDELRHAQDVREMYEQKLRRANNLYSELSQCMMQLEQRERDLLRREQQ
MVAMLSNHGLLSKKPNRIRYRLMRPMMLKGTGDRSVKGSPIGQGYVY
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgtggcaccgcgttcattgttggacgttgaagagctgtgccatttgcggaca
cagtcgttgccgaacaagctaccgccaccggcgcgtacgtcagcgcgccgggcgacggtc
agttgcggcgacggcgtcgactacgcgacgacagccgttgcgagttcggtcagacgtcgg
tcgacgggcgtcgttgtgggcgccggtatgaaacgtctcgacactgtcggtcaggatggc
cagtcgccgtcgtccggtcccaggttggacctctggtggcaagggttctggggctgcttg
cgaccgacggcggcggcgcctgcggccgctgcccaaaccgccgcggcggtgggctcgaaa
agcaacaagcagcagagcgccgccgacgactgggaagtgccgttcgaaagcatcaccgac
ctgcagtggctgggcgcaggctcgcagggcgcggtttttctcggacggttcaacggcgag
tcggtggcggtgaaaaagttgcaacgcatcggcgaaaccaacattcgacacctcagacac
ctctcccacccgaatgtcatcaaattcaggggtgtttgcacacaagctccatgctattgc
attattatggagtattgttcacaggggcaactgtacgaattgttgcgcagcggtaagcag
ttgtcgccgaaattgactttggactgggcaaagcaaattgccagcggtatgcactatttg
caccagcagaaaattatccaccgcgatttgaaatcgcccaacgttctggtgacaaatgaa
gatctgctcaaaatatccgactttggcaccagtcgacattggacccaagcgaacagtaca
cgaatgacattctgcggcactgcgtcttggatggcacctgaggtgatacgcaacgagccg
tgttcggacaaagtcgacgtctggtcgtacggcattgtactctgggagttgctcacctgc
gaggtgccttatcaagacgtggatccgacggccgtgatgtggggcgtcggctcgcacagt
ttgcaattgcccattcctcactcgacccccgaaggattgcaacttttgctcaagcagtgc
tggagcgccaagcctcgaaatcgaccctcctttcgacacatcctcacccatttggacatt
gcccaggctgagttggaatatttcacatttgaagcttggatctcgttgcagcagcgttgg
aaagttgaaattggcgatcgaatcaaaactctgcaccgcgctaaagatcgttcctgtttg
caaaagatcatcgaagatcagctcatcagccgtagaaaggacgaactgagacatgcgcag
gatgttcgcgagatgtacgagcagaaactacgtcgggcgaacaatttgtacagtgaactc
agccagtgcatgatgcagcttgaacagcgagagcgtgatttacttcgacgtgaacagcaa
atggtcgccatgctcagcaatcacggcttactgtcgaaaaagccgaatcgcatccgttac
cgtctcatgcgtccgatgatgttgaaaggtactggcgatcgatcagtcaaaggcagtcca
attgggcaagggtatgtatactga

DBGET integrated database retrieval system