KEGG   Trichinella spiralis: Tsp_09845Help
Entry
Tsp_09845         CDS       T01609                                 

Definition
ubiquitin carboxyl- hydrolase superfamily
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Tsp_09845
Peptidases [BR:tsp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tsp_09845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 330 aa AA seqDB search
FGNTCYCNSVIQALYFCRPFREKVLNYKSQMKKAGNQKENLLLCLADLFHSISTQKRRVG
TIAPKKFIGRLKKENDLFDNYMQQDAHEFLNYLLNTVADILLEEKRHEKRISGGHKTQVK
DKLAEHTWVHDVFQGTLTNETRCLNCETVSSKDEDFLDLSVDVQQNTSITHCLREFSATE
TLCNEHKYYCDICCSKQEAQKRMRIKKLPLILALHLKRFKYVEQYNRYTKLSYRVLFPLE
LRLFNTSHDAVNPDRMYDLVAVVVHCGSTPNRGHYITVVKSQGFWLLFDDDVVDKMDHIN
IEDFFGMAADGSLQKNSESGYILFYQARDI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
tttgggaatacatgttattgcaattcggtgattcaagctttgtatttttgtcggccgttt
cgcgagaaggtgctcaattataaaagccaaatgaagaaagctggaaatcaaaaagaaaat
ttgctgctttgtcttgccgatttgtttcatagcatttcaactcagaagcgacgagttggt
acaattgcccctaaaaaattcatcggtcgattgaaaaaggaaaatgatttgttcgataat
tacatgcaacaggatgcgcatgaatttttgaactatctgctcaacaccgttgctgacatc
ttgcttgaagagaagcgacacgaaaagcgtatttctggcgggcataaaacgcaggttaag
gataaattggccgaacatacttgggtgcacgacgtttttcaaggcacattgaccaacgaa
acacgatgcctcaattgtgagacggttagcagtaaagatgaagatttccttgacctcagt
gtggatgtgcaacagaatacgtctataactcattgtttgcgggaatttagtgcaacggaa
acactttgtaatgagcataaatattattgtgatatttgttgttctaaacaagaagctcag
aagagaatgcgaatcaaaaaattaccactgatactagcgttgcatttgaagcgtttcaaa
tacgtagaacagtataatcgttatacgaaattgtcttatcgagtgctttttcccctagag
cttcgcctctttaatacctcccacgatgcggtcaatcctgatcgtatgtacgatttagtg
gccgtcgttgttcactgtggcagtacaccaaatcgaggacactacattacagtggtcaaa
tcacaaggattttggcttctatttgacgacgatgttgtagataaaatggatcacattaat
attgaagatttttttggtatggccgctgatggtagcttgcagaaaaattctgaatccggt
tacatacttttctatcaggctagagatatctag

DBGET integrated database retrieval system