KEGG   Trichinella spiralis: Tsp_09991Help
Entry
Tsp_09991         CDS       T01609                                 

Definition
(RefSeq) putative 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain protein
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
tsp  Trichinella spiralis
Pathway
tsp00062  Fatty acid elongation
tsp00071  Fatty acid degradation
tsp00280  Valine, leucine and isoleucine degradation
tsp00310  Lysine degradation
tsp00380  Tryptophan metabolism
tsp00410  beta-Alanine metabolism
tsp00640  Propanoate metabolism
tsp00650  Butanoate metabolism
tsp01040  Biosynthesis of unsaturated fatty acids
tsp01100  Metabolic pathways
tsp01200  Carbon metabolism
tsp01212  Fatty acid metabolism
Module
tsp_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
tsp_M00085  Fatty acid biosynthesis, elongation, mitochondria
tsp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tsp_09991
   00650 Butanoate metabolism
    Tsp_09991
  Lipid metabolism
   00062 Fatty acid elongation
    Tsp_09991
   00071 Fatty acid degradation
    Tsp_09991
   01040 Biosynthesis of unsaturated fatty acids
    Tsp_09991
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tsp_09991
   00310 Lysine degradation
    Tsp_09991
   00380 Tryptophan metabolism
    Tsp_09991
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tsp_09991
Enzymes [BR:tsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Tsp_09991
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tsp_09991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_Gly3P_dh_N Pyr_redox_2 DUF3479 K-box
Motif
Other DBs
NCBI-GeneID: 10908092
NCBI-ProteinID: XP_003370780
UniProt: E5SXY5
Position
Unknown
AA seq 762 aa AA seqDB search
MATFFGLTTVARSTLSVKFQLLRLCNRCSTNISTLTRMNSYRDEEIGIIKFNTPGSKENI
MDINFMMEFYDCLNKFTQDDSVKGIVVMSGKSGSFIAGADTKIIASCHSVAEATALSLKC
QAIMNRIHSNYKPVVAAINGTCLGGGLELALACDYRIAVNSKKTVFGLPEVRLGLLPGAG
GTQRLPRLISIIDSMDLMLTGKTISASKAKSIGLVDMLVEPLGPGLHTDEDYMIKELEQG
AVQVLRDLLSTELVVLRKLKFPHNLVHTLLDIELFRNLFFVYMRNKVEKSTHGHYPAPSH
IVNVVRKGYKFGIGDGLKAEAKAFGLLATSPESKSLIHLFTLSTECKKNPFPPVKKEPKS
LAVIGAGLMGCGIAQVSIYNGFVTYLNDLDKEALLRGERSIAQHLDKKVKQQSITILEKD
NMLANLFLSVDREAIKNADLLIEAVFEDVELKQKVLREIEQCVRPDCVIASNTSAISISK
IAEASERPENIVGMHYFSPVDKMKLLEVITTSKTSKEAASAAVNVGLRQGKLVIVVKDSP
GFYTTRILAAMLSETIRLLQEGVSPKELNDLCIGFGFPVGFVTLVDEVGIDVALHIAKYL
GEKLGQRMAGGDISVLQKMEENLEKDVSIIRNQKSNNDSDHDRQLRMVSRFVNEALLCLE
EGVISSPVQFLLRSGDIGAVFGLGFPPFWGGEFIDGGQHCIVRILLSFAKRRPFRFVDNY
GAERLVKEMDRYRDCYGDAAEFQACQLLRDHANDSKKKFYTI
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcaacattttttggtttaactacagtagctcgcagtactctgagcgtgaaatttcaa
ttgttacgcctgtgcaatcgttgctccacaaatatctcaacgttgacaagaatgaatagc
taccgtgacgaagagattggaattatcaaatttaacacaccaggatccaaggaaaatatt
atggatatcaattttatgatggaattttacgactgtttgaataaatttacacaagatgac
tctgtcaaaggtattgttgtaatgtcagggaaatctggaagttttattgctggtgccgat
acgaaaattatcgccagttgccattcagtcgcagaagcaactgcgttgtctttgaaatgc
caagctattatgaatagaattcattccaattacaagccagttgtagcagccattaatggt
acttgtcttggcggtggtttggaacttgcgttggcatgtgattatcgcattgctgtaaat
tcgaagaaaacagtttttggattgcctgaagttcgacttggtttactgccaggagctggt
ggaactcaacgtttgccgagattgatatcaatcatcgatagtatggatttgatgctcaca
gggaaaacaatatctgcatccaaagcgaaaagtattggtttggtggacatgctcgttgaa
ccgttgggtccaggattgcatactgacgaagattatatgatcaaggaattggaacagggc
gctgttcaagttttacgagatcttctatccacagaacttgtcgttttgagaaaactgaaa
tttcctcacaatttggtgcacacattgttggatattgaattattcagaaatttgttcttt
gtttacatgcgcaacaaagttgaaaaatcgactcatggccattatcctgcgccttcccac
attgtgaacgtggtgagaaaggggtacaaatttggaattggagacggcttgaaagccgaa
gctaaggcattcggcttgttggctacgtctcctgaatccaaaagtctcattcacttgttc
actttatctaccgagtgcaaaaagaatccatttcctcccgtgaaaaaggaaccaaaatct
ttggcagtgattggagccggcttgatgggatgcggaattgcccaagtgtcgatttacaat
ggttttgtgacttatttgaatgatttggacaaggaagctcttcttcgaggcgagagatcc
attgcccaacatttggacaagaaggtgaaacagcaatctataacgatattggaaaaggat
aacatgttggctaatttgtttttgtcagttgatcgtgaagcgataaagaatgcagatttg
ctcatcgaggcagtctttgaagatgtcgaactgaagcagaaagtattgcgtgaaattgaa
cagtgtgttcgaccagactgtgtcattgcttcgaacacgtcggcaatttcgatttcaaaa
attgctgaagctagcgaacgaccagaaaatattgttgggatgcactatttttcaccggtc
gacaagatgaaactgttggaagtgatcactacgtcgaaaacgtcgaaggaagcagcttct
gcggcagtgaatgttgggttgagacaaggcaaattggtcattgtggtcaaagatagtcct
ggattttacactactcgcattttggcggcgatgctttctgaaacgattcgtctgttgcag
gaaggtgtcagtcccaaagagttgaacgacttgtgcattggcttcggttttcctgtaggt
tttgtgactttggtagacgaagtaggcattgatgtggcattgcatattgcaaaatatttg
ggagagaagcttggccaacggatggccggtggcgatatatctgttttgcaaaaaatggaa
gaaaatctggaaaaggatgtttcgattattcgaaatcaaaagtcaaacaatgactctgac
cacgacaggcagcttcgaatggtgagtcgattcgttaacgaagctttgctctgcttagaa
gaaggcgtcatctcttcaccggtacaatttttgctaagaagtggtgatattggtgcggtt
tttggtttgggatttccaccgttttggggaggtgagttcattgatggtggtcaacattgt
attgttaggattttgttatcatttgcgaagagaagacctttccgatttgtggacaattat
ggcgccgaacgtttggtgaaggaaatggaccgatatcgtgattgttacggagatgcggcc
gaatttcaagcatgtcagcttctgcgagatcatgcgaacgattcgaagaaaaagttttat
accatttga

DBGET integrated database retrieval system