KEGG   Trichinella spiralis: Tsp_10062Help
Entry
Tsp_10062         CDS       T01609                                 

Definition
protein disulfide-isomerase A3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
tsp  Trichinella spiralis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Tsp_10062
Enzymes [BR:tsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tsp_10062
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Tsp_10062
  Exosomal proteins of colorectal cancer cells
   Tsp_10062
  Exosomal proteins of bladder cancer cells
   Tsp_10062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 486 aa AA seqDB search
MMYLACFLCLLFSTGLLGSDVLEFTDSTFDERIKQYDLILVEFYAPWCGHCKRLAPEYEK
AATLLKNADTPVPLAKVDCDANKVLCETQNVRGFPTLKIFRKGSYVSDYDGPREANGIYK
HMGGMVGPSSKELKTADDFKKFIDSKEFTVVGFFEKESKLKDSFLKVADLERTKFRFGHT
SNKEILKEHSVSDDIIVFVPKKYHNKFEDSKVVYEGNFDSDRIKKFLNSEIYGLCGHRQV
DNAGSFAKPLLIAYYDVDYERNPKGTNYFRNRIMKVAKEFKRKLTFSISNKDEFAGEIES
FGLSDDVDKQNMIVAVLDKDKRKYVMKDEFSVENLKTFVENFLAGKLEPSIKSEPIPETN
DNPVKVVVAKTFDDFMKQDKDILLEFYAPWCGHCKNLAPIYDQLGIKMENEDVLIAKIDA
TANDIPDNFEVHGFPTLYWVPRNAKDKPQSYTGGRTLDDFIKYIARHATNELKGWDRNGK
PRKEEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatttggcgtgctttttgtgtttacttttctccactggactacttggtagtgac
gttcttgaattcaccgatagcacctttgatgaacgaataaagcagtatgatctcattttg
gtcgaattttacgctccatggtgtggtcactgcaaacgattggctcctgaatacgaaaaa
gcggctactcttttaaaaaatgcggatactccagttcctcttgctaaagttgactgcgat
gcgaataaagttctttgcgagacgcaaaacgtgcgtgggtttccaacgttgaaaattttc
cgcaaaggcagctatgtgagcgattacgatggtccccgtgaagctaatggaatttacaag
catatgggtggtatggtcggccccagttcaaaagagttgaagacagctgatgattttaaa
aagtttatcgactcaaaggaatttaccgtagttggcttttttgaaaaggaatcaaaattg
aaagattctttcttgaaagttgctgatttggaaagaacgaaattccgctttggtcatact
tcaaacaaggagattttgaaagagcacagcgtcagcgacgatattatcgtttttgttccc
aagaaatatcacaacaaattcgaagacagcaaagtagtttacgaaggaaattttgattca
gatcgtatcaaaaaatttctgaactctgaaatatatggcctttgtggacatcgtcaagtt
gacaacgctggctcatttgctaagccattgttgattgcttattacgatgttgattacgag
cgtaacccaaaaggtacaaattattttcgtaatcgaataatgaaggtagcgaaagagttc
aagcgcaaactgacattttccatctcgaacaaagatgaatttgccggagaaattgaaagc
tttggtttgagtgacgatgtagacaagcaaaatatgatagttgctgtccttgacaaagat
aaacgcaaatatgtgatgaaagatgaattcagtgttgaaaacttgaaaacctttgtggaa
aacttcttggcaggaaagttggaacccagcatcaagtcggaacccattcctgaaacaaat
gacaatccggtcaaggttgttgtagcgaaaacattcgacgattttatgaaacaagacaaa
gatatattgctggaattctatgcaccttggtgtggccattgcaaaaacttggctccaatt
tacgatcaactcggcataaaaatggaaaatgaagatgttttgattgcgaagattgacgct
actgcaaatgatattcccgataatttcgaggttcacggatttccgactttgtattgggtg
ccacgaaatgccaaggacaaaccgcagagctataccggcggtcgtacattggatgatttc
atcaaatacattgctcgtcatgctacaaatgaattgaaaggatgggaccgtaatggaaaa
cctagaaaagaagaattgtaa

DBGET integrated database retrieval system