KEGG   Trichinella spiralis: Tsp_10065Help
Entry
Tsp_10065         CDS       T01609                                 

Definition
putative tetratricopeptide protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tsp  Trichinella spiralis
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Tsp_10065
Protein phosphatases and associated proteins [BR:tsp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Tsp_10065
Ubiquitin system [BR:tsp04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Tsp_10065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 692 aa AA seqDB search
MVHTLLEYYMYDDAIEAAEFFHSIDKTEDALFLLASCYVRAGKFDMAINLINSKLITSTR
LKYLLGRCYFAKQDKWDKAVIALSQVAGDSSLIGAFASSMLAFMHNRSQPMSALSNHRNA
LKKCPYLFTSLRGLLHLRRDFQPINFFPSIKKERTRLDDLQLLWRAEMIGQDPLFSQRLK
LSTIPYSMLIPRCEFDISDEEEEEEESDMECSPPKYVSPWRQLKPANLCSGRHGGKGRKK
RKTTSRKVRYTLEQVVDPLVVRENSNNTKDVNPPTEDLSNANNSVRTQSPSKLKKEAPKP
FVLVCSELSTLIKASLSDEMRRNVIENCEKKKLHYDIRLLAETYCLVMEIEVALANYHFE
EAHNRYYKLRRELRICPAALRAVARTYLEESNYKEAVYYYEMYHREYPHLTDDIDYYSTA
LWYLRRESSIAFLCCDMLNTAYDDPHTWAVLGNACSLKKRHELAIQCLERALELDKHYFY
GHILLGHEWSALDDTDQADHYFKEALRLRPRHHSPWFSLGYVAFRSQDMENAEAYLLRSL
SLNPKSPSIQLISLLKVLEARGRKRMAGQILNYTLKIAPNNTFCRFTRAMAQKELMDLKR
IIPSEPIVYFLLGRVYKEMNEPHSAMVNFAHAVTLDPNLEQLQVMAQQNSREHRFSIMSL
EGIIQPCRSRLNFPCVDHDDDDQAYYCLIVDW
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacactctgttggaatactacatgtacgacgatgccattgaagcagcagagttt
ttccattccattgataaaactgaagatgcgctgtttttgcttgcgtcttgttatgtacga
gccgggaaatttgatatggcaatcaacttgataaatagtaaattgataacttcgaccagg
ttgaaatatttgcttggtcgatgctattttgctaagcaagacaaatgggataaagcggtg
attgctctttcccaagtcgctggagattctagcctgatcggtgcatttgcgagttccatg
cttgctttcatgcacaacagatcgcagccgatgtcggcgctaagcaatcaccggaacgcg
ttgaagaaatgtccatatttgtttacatcgcttcgtggcttattgcatttgaggcgtgat
tttcaaccaatcaatttttttccttcaattaaaaaagaacgcacccgactcgacgatttg
caacttttatggagagctgaaatgattggtcaagatccgttgttttcccaacgattgaaa
ctgagcacaattccatattcaatgcttattcctcgttgtgaattcgatatttctgatgaa
gaagaagaagaagaagaaagtgatatggaatgttcaccaccgaaatatgtatctccatgg
cgtcagttgaagccggcgaatctttgttccggccgacatggtggaaaaggcaggaagaaa
cgaaaaactacatcacgcaaggtccgttacactctagaacaagttgttgatccgttggtt
gtaagggagaattcaaacaatacaaaagatgtcaatccaccaacggaagatttgagcaat
gcaaataatagcgtgcgaacgcagagtccgtcgaaattgaaaaaagaagcaccgaagccg
tttgtgcttgtatgttctgagctgtccacattaattaaggcttctttatctgacgagatg
cgcagaaatgtgattgaaaactgtgaaaaaaagaaattgcattacgacatccgtttgtta
gctgaaacatattgtctggtgatggagattgaagttgctttggctaattatcatttcgaa
gaggctcacaacagatattacaaattgcgacgtgagctacgaatttgtcctgcggcgttg
cgagcagtcgcgagaacatatttagaagagtcgaattacaaagaggctgtttactattat
gaaatgtatcatcgtgagtatccgcatttgacggatgatattgattattacagtactgca
ttgtggtatttgcgtcgagaatcaagcattgcattcttgtgttgtgatatgcttaataca
gcctatgatgatccacatacatgggcagtgcttggaaatgcatgcagcttaaaaaaacgt
catgaattggcaattcagtgtcttgaacgcgcattagaactagacaagcattatttctat
ggacacatactgcttggtcacgaatggtcagctttggacgatactgatcaagctgatcac
tatttcaaagaagctttgagactccgtccacggcatcactctccttggttttccttaggt
tatgttgccttcagatcgcaagacatggaaaacgccgaggcatatttgcttcgttcgttg
agtctcaacccaaaatctccgtccattcagttgataagcttgttgaaggtgttagaagct
cgtggtagaaagagaatggcaggacaaattttgaattatactttgaaaattgcaccgaat
aatacattttgtcgttttacaagagcgatggcccagaaagaactgatggatttgaaacgt
ataatacccagtgaaccgatagtctactttttgcttggcagagtttacaaagaaatgaat
gaaccgcacagtgctatggtaaactttgcacatgctgtaacgttggatccgaatttagaa
cagctgcaagttatggctcaacagaattcgagagaacatcgattttccatcatgagtttg
gaaggtataattcagccttgccgaagccgtctaaattttccgtgtgttgatcatgatgat
gatgatcaagcttactactgtctgattgttgactggtga

DBGET integrated database retrieval system