KEGG   Trichinella spiralis: Tsp_10065Help
Entry
Tsp_10065         CDS       T01609                                 

Definition
putative tetratricopeptide protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tsp  Trichinella spiralis
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:tsp04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 692 aa AA seqDB search
MVHTLLEYYMYDDAIEAAEFFHSIDKTEDALFLLASCYVRAGKFDMAINLINSKLITSTR
LKYLLGRCYFAKQDKWDKAVIALSQVAGDSSLIGAFASSMLAFMHNRSQPMSALSNHRNA
LKKCPYLFTSLRGLLHLRRDFQPINFFPSIKKERTRLDDLQLLWRAEMIGQDPLFSQRLK
LSTIPYSMLIPRCEFDISDEEEEEEESDMECSPPKYVSPWRQLKPANLCSGRHGGKGRKK
RKTTSRKVRYTLEQVVDPLVVRENSNNTKDVNPPTEDLSNANNSVRTQSPSKLKKEAPKP
FVLVCSELSTLIKASLSDEMRRNVIENCEKKKLHYDIRLLAETYCLVMEIEVALANYHFE
EAHNRYYKLRRELRICPAALRAVARTYLEESNYKEAVYYYEMYHREYPHLTDDIDYYSTA
LWYLRRESSIAFLCCDMLNTAYDDPHTWAVLGNACSLKKRHELAIQCLERALELDKHYFY
GHILLGHEWSALDDTDQADHYFKEALRLRPRHHSPWFSLGYVAFRSQDMENAEAYLLRSL
SLNPKSPSIQLISLLKVLEARGRKRMAGQILNYTLKIAPNNTFCRFTRAMAQKELMDLKR
IIPSEPIVYFLLGRVYKEMNEPHSAMVNFAHAVTLDPNLEQLQVMAQQNSREHRFSIMSL
EGIIQPCRSRLNFPCVDHDDDDQAYYCLIVDW
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacactctgttggaatactacatgtacgacgatgccattgaagcagcagagttt
ttccattccattgataaaactgaagatgcgctgtttttgcttgcgtcttgttatgtacga
gccgggaaatttgatatggcaatcaacttgataaatagtaaattgataacttcgaccagg
ttgaaatatttgcttggtcgatgctattttgctaagcaagacaaatgggataaagcggtg
attgctctttcccaagtcgctggagattctagcctgatcggtgcatttgcgagttccatg
cttgctttcatgcacaacagatcgcagccgatgtcggcgctaagcaatcaccggaacgcg
ttgaagaaatgtccatatttgtttacatcgcttcgtggcttattgcatttgaggcgtgat
tttcaaccaatcaatttttttccttcaattaaaaaagaacgcacccgactcgacgatttg
caacttttatggagagctgaaatgattggtcaagatccgttgttttcccaacgattgaaa
ctgagcacaattccatattcaatgcttattcctcgttgtgaattcgatatttctgatgaa
gaagaagaagaagaagaaagtgatatggaatgttcaccaccgaaatatgtatctccatgg
cgtcagttgaagccggcgaatctttgttccggccgacatggtggaaaaggcaggaagaaa
cgaaaaactacatcacgcaaggtccgttacactctagaacaagttgttgatccgttggtt
gtaagggagaattcaaacaatacaaaagatgtcaatccaccaacggaagatttgagcaat
gcaaataatagcgtgcgaacgcagagtccgtcgaaattgaaaaaagaagcaccgaagccg
tttgtgcttgtatgttctgagctgtccacattaattaaggcttctttatctgacgagatg
cgcagaaatgtgattgaaaactgtgaaaaaaagaaattgcattacgacatccgtttgtta
gctgaaacatattgtctggtgatggagattgaagttgctttggctaattatcatttcgaa
gaggctcacaacagatattacaaattgcgacgtgagctacgaatttgtcctgcggcgttg
cgagcagtcgcgagaacatatttagaagagtcgaattacaaagaggctgtttactattat
gaaatgtatcatcgtgagtatccgcatttgacggatgatattgattattacagtactgca
ttgtggtatttgcgtcgagaatcaagcattgcattcttgtgttgtgatatgcttaataca
gcctatgatgatccacatacatgggcagtgcttggaaatgcatgcagcttaaaaaaacgt
catgaattggcaattcagtgtcttgaacgcgcattagaactagacaagcattatttctat
ggacacatactgcttggtcacgaatggtcagctttggacgatactgatcaagctgatcac
tatttcaaagaagctttgagactccgtccacggcatcactctccttggttttccttaggt
tatgttgccttcagatcgcaagacatggaaaacgccgaggcatatttgcttcgttcgttg
agtctcaacccaaaatctccgtccattcagttgataagcttgttgaaggtgttagaagct
cgtggtagaaagagaatggcaggacaaattttgaattatactttgaaaattgcaccgaat
aatacattttgtcgttttacaagagcgatggcccagaaagaactgatggatttgaaacgt
ataatacccagtgaaccgatagtctactttttgcttggcagagtttacaaagaaatgaat
gaaccgcacagtgctatggtaaactttgcacatgctgtaacgttggatccgaatttagaa
cagctgcaagttatggctcaacagaattcgagagaacatcgattttccatcatgagtttg
gaaggtataattcagccttgccgaagccgtctaaattttccgtgtgttgatcatgatgat
gatgatcaagcttactactgtctgattgttgactggtga

DBGET integrated database retrieval system