KEGG   Trichinella spiralis: Tsp_10538Help
Entry
Tsp_10538         CDS       T01609                                 

Definition
josephin-2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Tsp_10538
Peptidases [BR:tsp01002]
 Cysteine Peptidases
  Family C86
   Tsp_10538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 265 aa AA seqDB search
MTSLDEIVTTLNVTHIYHEKQYLQRCALHALNNLFQAEIFTKKQLDDICLRLSPSYLLNP
HRSAFGLGNYDINVIETALQGVGCVALWFDKRKDVRSIDLANIVGLIINVPVNSKIFNFS
LPFATRRHWVGIFIYHNMQHYLTAVAMIFFNFSIRKINGKFYNLDSKLTSAQCIGSDEEM
LQYIFQILTNKGVQMFIIVRKEIFCILAQNLCLANFVRENLKIDCNISLYTVFSFCLVCN
LCLGYFVPVARIRCYFLTKVLSDVW
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacaagccttgatgaaatagtgacaactctgaatgttacgcatatttaccatgaaaaa
cagtatcttcaacgttgcgcactgcatgcgctgaacaacttgtttcaagcagaaatattt
actaagaaacagttggacgacatttgtttgagactctccccatcttacttgctgaatccc
catcgaagtgcatttggtcttggcaactatgatataaatgtaatagaaacggctttgcaa
ggagttggttgcgtagcgctatggtttgacaagagaaaagatgttcgaagcattgacttg
gcaaacattgttggactaataatcaatgtgccagtcaattcaaaaattttcaatttctca
ttaccatttgctacgcgaaggcattgggtaggcatttttatttaccataatatgcaacat
tatttgacagcagtggctatgatattttttaacttttccatacgaaaaattaacggaaag
ttttataacttggactccaaattgacgagcgcacaatgcattggtagtgacgaagagatg
ctccaatacatatttcaaattttgaccaataaaggagtgcagatgtttattattgttcgt
aaagaaattttttgtattctagctcaaaatttatgcttagcaaattttgtacgtgaaaat
ctaaaaattgactgtaatattagtctgtacaccgtattcagtttctgtcttgtttgcaat
ctttgtttaggttattttgtaccagttgcacgtattcggtgttattttttaacgaaagtg
ttatccgatgtgtggtga

DBGET integrated database retrieval system