KEGG   Trichinella spiralis: Tsp_10647Help
Entry
Tsp_10647         CDS       T01609                                 

Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tsp  Trichinella spiralis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tsp_10647
Enzymes [BR:tsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Tsp_10647
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tsp_10647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 671 aa AA seqDB search
MSDRPPFLNNLLQLDGYLKNYENEICRRYGEFKRLVMQINKEEGGLDKFSRGYEKFGVVV
TPENGVFCQEWAPGADGLFLIGDFNNWDRTAHPYDRKDFGKWELYIPPNADGSCPIPHKS
VLKIMVAKDGGFCDKISPWATYVCCPSDSIVYHHVFYNPPQKYKFLYNKPEKPVALRIYE
CHIGISSPEGKVASYVYFTNNIIPRIVKQGYNAIQVMAVMEHAYYASFGYQVTNFFAASS
RYGTPCDLKFLVDKAHELGIFVLLDIVHSHASKNTADGLNQWDGTNGCYFHDNYRGYHTS
IICILEKKTINLFYYSRRETLRFLLSNLRWWIEEYHFDGFRFDGVTSMIYHSHGLGEFRM
LLLCFCAWKMFIVLHLGSGFSGHYDEYFGLSVDTESLLYLTTANYMLHKFYPSVVTIAEE
VSGMPALCRPVEEGGQGFDYRLAMAIPDKWIKLLKHYRDEDWNMGDLVFTLENRRYGEKN
IAYAESHDQALVGDKTIAFWLMDKEHIAGNEFGHPEWLDFPRQGNNSSYHYCRRQWNLVD
DPLLRYKFLNNWDRAMNLAEEKYHWLSAGPAYTSWKHDQDKVIAFERANLLFVFNFHVNK
SYTDYKIGVNKSGKYKMILDSDAEEFGGHQRLDSSCEWFTFPHEYANRANHLCVYAPSRC
CFVLALDSDLS
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcgccctccgttcctcaataatttgctgcaacttgacggttatttgaaaaac
tatgagaatgaaatttgccgcagatatggcgaattcaagcgactggtcatgcaaattaac
aaagaagaaggcggtttggataagttttcgcgaggctatgaaaaatttggtgttgttgtg
acacccgaaaatggagtattctgtcaggaatgggctcccggagcggacggtctttttctg
attggtgacttcaacaattgggatcgtactgcgcatccttacgatcgtaaggattttgga
aaatgggaattgtacattccgccaaatgcggatggttcatgccctattccacacaaatca
gttttgaaaataatggttgccaaggatggtggattttgtgacaaaatttcgccctgggca
acctacgtctgctgcccttcggattctattgtttatcatcatgtgttttataatccaccg
caaaagtacaagtttctctataacaagcctgaaaaaccagtagcacttcgcatttacgaa
tgccatattggaatttcttctccagaaggaaaagtagctagttatgtgtattttacaaac
aacatcatacctagaatagtaaagcaaggttataatgcaattcaagttatggcggtaatg
gagcatgcttactacgctagctttggttatcaagttacaaatttctttgctgcttctagc
cgctacggtacaccgtgtgatttgaaatttctggtcgataaggcacacgaattaggtatt
tttgttttgttggatattgtacacagtcatgcgtcgaagaatacagccgacggactaaat
cagtgggatggaacaaatggatgctattttcacgacaactaccgaggatatcatactagt
ataatttgcatattggagaagaaaacaattaatttgttttattattcaaggcgagaaacg
ttgcgttttttgttgtccaatttgcgctggtggatagaagagtatcattttgacggcttt
cgcttcgacggtgtcacgtcgatgatataccactcgcacggtttaggtgaattcaggatg
ttattactttgtttttgtgcgtggaaaatgtttatcgtgcttcatttaggttcgggattt
tctggtcattatgatgaatattttggactgtccgttgacacagaatcgttgttgtatttg
acgacagccaattatatgcttcacaagttctatccgtcggttgttaccattgccgaggaa
gtcagtggcatgccggcgctttgtcgtccagtggaagagggcggtcaaggatttgactac
agactagcaatggcaataccggacaagtggataaagctgttgaaacattaccgagatgaa
gattggaacatgggagatctcgtgtttacgctggaaaatcgtcgatatggggaaaaaaat
atcgcttatgctgaatcgcacgaccaagctttggtcggcgacaaaaccatcgccttttgg
ctgatggataaagaacacattgcaggcaacgaattcggccatcccgaatggttggatttt
ccccgtcaaggcaacaacagcagctaccattattgccgtcgtcagtggaatttagtggac
gatccattgttgagatacaaatttttgaacaactgggatcgagcgatgaatttagccgaa
gagaagtatcactggctgagcgccggtccggcttacacatcgtggaaacacgaccaggac
aaggttattgcttttgaacgtgccaacttgctgtttgtattcaattttcatgtcaacaaa
agttacacagattacaaaattggcgtcaacaaatcaggaaaatataaaatgatattggac
agtgatgctgaagaatttggtggccatcagcgcttggattccagctgcgagtggtttaca
tttccacatgagtatgctaatcgagcgaatcatctttgcgtgtatgcgccgagccgttgt
tgttttgtgctggccttagattcagatttgtcttag

DBGET integrated database retrieval system