KEGG   Trichinella spiralis: Tsp_10943Help
Entry
Tsp_10943         CDS       T01609                                 

Definition
(RefSeq) voltage-dependent calcium channel unc-36
Organism
tsp  Trichinella spiralis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1108 aa AA seqDB search
MTETAFAGLFFRLFALAAELHAQDLRGRGAIPISASMCVLVVEQWAKSFGLDLYSTATTA
TQAEELEQKYQEKNARVEYFDPEEVIDVMKARLEKFLGRRRQLAEILKENLENSYSLFQM
VDREAINDLQSDDFYRFVDSKSCLNRHYVDPLLINSSLSVSYIPNPNFFNLPVNTEKSAI
HVPTPVYARDPELLSEIIWTESLDDIFKARRAREFFAASWQYFCSQKGFMRFYPASPWFY
DDSHTCLDMYIDAATHAKNIIIMLDMSGSMLGQRFEIAKQTIEMILETLTENDFFNMIVV
RCGVFSEEPKFILSCFRNRLVQATIKNKKLMRVTLDNVTAEGIANYPAALSLAFEVLIEA
SQNPGVNSGCQNAIMLITDGPSDTYEDIFEKYNKDKTIRFFTYLIGDDVTETREVRWMAC
YNRGYFAHISNLADVQEKVQSYIGVMSRLTPERNRTDPVWTGAYYDRLGAVLVATVAFPV
VANDSFRGVVGASALITELQQMAPLYMLGTHSYTFIVDNNGYVVHHPQLRPLYMGKAKPH
YNSMDIMEMEVLADNYLVAIFCFEFYCYLVIENGSLANPVDYDSDLRRHLADGVSSKDFL
RKFSQKVIWACDGPNNLRRVYLQNNVYHYRGINNTLMSLALAVPEDSRYRIALPSTYSPY
PYKNIDCKAGALYTYLIERLLFDAEVTSQMDSAWIQESRLDERKGVHLVYLATHAGLTRF
VSMDLKDVQYQPDVQTWPSDDNRTEELPTTLDKPYFHFSKRHTRALDEVFYKRAMQFLNG
EFVFDINITNNIYLKNGSQTYPHAKDGRSIIVTGNRAILVRDDYGNEAPASVVGFEMLYA
SFEEMIYNASHKMCHIRSLFNSKVRCYLLDEHGYIVYASLPHTSQERVHYLRQFFGHLSL
ENTENGAIERYLMKKLVDLFVYQKLLYVDFQDLCQNLNLYNSARRYTATFRDIQDGLPCD
RASSFYLLNNDFKGPLTLAEGKQLCSSVATSDSYARVSSCNLYAYAVRIEKTNLVLVVYS
TEGTQCNGDLCKDYFSRDSLPWGFNIALNATDKVMHPQACKLTTRYRRPPSACQAVEDDD
PFAHCSGCSSQATLSLVLLCTVVLFVVR
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaactgcatttgctggcttgtttttccggctgtttgctttggcagcagaatta
catgcccaagatctgcgtggtagaggcgctattccaatcagcgcttcaatgtgtgtattg
gttgttgaacagtgggcgaaaagtttcggcttggatctgtattcgaccgcaacaacggct
actcaagccgaagaacttgaacaaaagtatcaggaaaaaaatgcacgggtagaatatttt
gatccagaagaagttatcgatgtgatgaaagctcgtctggaaaagtttttaggtcgaaga
cgacaattagctgagattttgaaggagaatttggaaaattcttacagtcttttccagatg
gtggacagagaggcgataaatgatctccaaagcgatgatttttatcgatttgtcgactcc
aagtcatgcttgaatcgacactatgtcgacccattgctaattaattcatctttgtctgtc
agctatattccaaatccaaactttttcaatcttccggtaaacactgaaaaatcagcaatt
catgtgcctacaccagtttacgctcgagatccagaattgttaagtgaaatcatttggacc
gaaagtttggatgatattttcaaagctcgtcgagctagagaatttttcgctgccagttgg
cagtatttttgctcgcagaaaggttttatgagattttatcccgcctctccttggttttac
gatgattctcacacatgtttggacatgtacattgatgcagccactcatgcgaagaatata
atcatcatgctcgatatgagtggttcaatgttgggtcagcgttttgaaattgccaaacag
acaatagaaatgattttagaaacacttactgaaaacgatttttttaacatgatcgtggta
cgttgcggtgtattttctgaagaacccaaatttattttatcttgctttcgaaatcgcttg
gtacaggcgacaatcaaaaataaaaagttgatgcgagtcactttggataatgtcacagca
gaaggcattgccaattatccagctgcgttatcattagcatttgaagttttaatcgaagca
tctcaaaatcccggagttaacagtggctgtcagaatgcgattatgctcattaccgatggg
ccgagtgatacctacgaagatatatttgaaaagtacaacaaagataagacgattcgattt
tttacatatttaatcggtgatgatgtaaccgaaacgagagaggttcgttggatggcttgt
tacaatcgtggttattttgcgcacatctcaaacttggcagatgtgcaagagaaagttcaa
tcctacattggtgttatgagtcgcttgacacccgaacgcaatcgcactgatcctgtgtgg
accggtgcatattacgaccgtttgggagctgtacttgttgctacggtagcatttccggtg
gtggcgaatgattccttccgtggagttgttggagcgtcagcattgattaccgaattgcaa
cagatggctccactttatatgcttgggacacattcttatacttttattgttgacaacaat
ggatatgtagttcatcatcctcagcttcgtccattgtatatgggtaaagcgaaacctcat
tataacagtatggatataatggagatggaagttttggctgataattatttggtagccatt
ttttgttttgaattctactgttatttggtgatcgaaaatggctcgcttgcaaatcctgta
gattatgacagcgatctgagacgtcatctggcagatggtgtgagtagtaaagattttttg
cgaaaattttctcagaaagtaatttgggcatgcgatggtcccaacaatttgagacgagta
tatttgcaaaataatgtatatcattatcgcggtattaacaacactttaatgagcttagcg
ttggctgttcctgaagattcgagatatcgaattgccttaccttcgacatattcaccatat
ccatacaagaacattgattgtaaggctggtgctctgtatacatatctgattgaacgtttg
ttattcgatgctgaagtgactagtcaaatggactctgcttggattcaagaatctcgactt
gatgagaggaaaggtgttcatttggtttatttggcaacccatgctggtcttactcgattt
gtgagcatggatttgaaagatgttcaatatcaacctgatgtgcaaacttggccatcggat
gataacagaactgaagaattaccaaccactctagacaagccatattttcatttttccaaa
cgacacactcgagctttggacgaggtattttacaaaagagcgatgcagtttttgaacggc
gaatttgtttttgacatcaacattacaaataatatatatttaaaaaatggatctcaaact
tatccacacgcgaaagatggtcgaagtataattgtcacaggcaatcgtgccatacttgtg
cgtgatgattacggcaacgaagcaccggctagtgtagttggctttgagatgctttacgcc
agttttgaagagatgatttacaacgctagccataaaatgtgccacatacgatcgcttttt
aacagcaaagttagatgctaccttctcgatgaacacggctatattgtctacgcctcattg
ccacatacgtcgcaagaacgtgttcattatttgcgtcaatttttcggacatctgagtctg
gagaataccgaaaatggtgctattgagagatatttgatgaagaaattggtcgatttgttc
gtttatcaaaaattgttgtacgttgattttcaagatttatgccagaacttgaatttgtac
aattccgcaagacgttatacggcaacatttcgagatattcaagatgggttgccatgtgat
agggcatcgtcgttttatttgttgaacaacgacttcaaagggccactgacgttagctgaa
ggcaagcagttgtgctcttcagtagcgacgagtgattcgtacgcgagagtcagttcgtgc
aatttgtacgcttatgcagtacgaattgaaaagacgaatttagttttggttgtatacagt
acagagggtacgcagtgtaacggtgacctctgcaaagattatttttcaagggacagtctt
ccttggggatttaatattgctctgaatgctactgacaaagtaatgcatccacaagcatgt
aaacttaccacccgttatcgtagaccgcctagcgcctgtcaagcagtggaagatgatgat
ccatttgcacactgtagcggctgttcgtcgcaggctacactatcactagttctactttgc
actgttgtgctatttgttgttcgatag

DBGET integrated database retrieval system