KEGG   Trichinella spiralis: Tsp_11048Help
Entry
Tsp_11048         CDS       T01609                                 

Definition
putative UBA/TS-N domain protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Tsp_11048
Peptidases [BR:tsp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tsp_11048
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tsp_11048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 785 aa AA seqDB search
MDEIAYVAPERGSTIYKDECVFCFDSPEFEHGLYICLVCHVGVCRNHVVMHVARTDHLLL
DDNDDDDAAPPKQITKLAIGVESGFLEKRYEVRERWAVSVYPQLELVPLFESTLGPGLLY
CCKAIMEAESAYRLLEVQSQAGTWDGTMLKNTIHTNLFQVDNPPKIPPSGWRCQAEGCDK
IDNLWLNLTDGMIFCGRKLWGGGGGNNHSMDHYCKTGYPLSVKLGTISSNGADVFSYDED
DLVNDPQLEKHLKHFGIDLAVMEKTEKSMIELELDFNQKWEFHEIQEEGNKLTPVYGPGY
TGMVNMGNSCYLNSVIQALVIIPDIVRVYWDGADRIFQNCSLVPCDDFNVQFAKVVSGLL
SGRYSRADMEDRRGIRPAAFRLLINRGNAEFASNRQQDVEEFMRYLFERLEQNKRGIDCV
EDVVSAWRFSLEEKLTCLESGNVSYKQRPEVILSLPVPLDLEQEQIDSTTLVNDENRPPS
VMGILPDEPAQLAMMNGAGGVAGAGVDSSGGGSGAGNDATEIVVTSSSNSGAATVETGVI
GPKLRPTVSLMNCLKALVEPELLDNTKSPFTGRISAMEKQLHFNTFPDWLWIQMKKFTFA
PDWRPLKLDVSIAVPDLLDMNEFRGSGPHVGKLTMEYTKDSDDEQQPSAKPELVSQLIDM
GFAESDVRTALIETANNLEIAVQWLLSGGVDGQGSGGAGGGSFNSRLSNDAPSSTEVQFR
DGDGLYRLRGFISHIGSSAHTGHYVCHLLKGDQWIIYNDEKVALSEKPPKDLGYVFLYER
ISTTD
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaattgcgtacgttgctccggaacgtggatcgacgatttacaaggacgaatgt
gtgttttgtttcgattctccagaattcgaacacggcctgtacatatgtctcgtatgtcat
gtgggcgtgtgtcggaaccacgtcgtcatgcacgttgcacgaaccgaccacttgctgctc
gacgacaacgacgacgacgatgctgcaccaccgaaacaaattaccaaactggcgattgga
gtcgaaagtggatttttggaaaaacgttacgaagtgcgagaacgatgggcagtttccgtt
tatccgcaactggaactggtccctttgttcgaatcgaccctcggtccaggtttgttgtat
tgttgcaaagcgatcatggaagccgaatccgcttatcgtctgttggaagttcaaagtcaa
gctggcacttgggacggcacgatgctgaaaaataccatccatacgaatttgttccaggtg
gacaatccgcccaaaattccaccgtccggttggcgttgccaagccgaaggttgtgacaaa
attgacaatctctggctcaaccttaccgacggtatgatattctgcggacggaaattgtgg
ggcggaggcggtggcaacaaccactcgatggatcattattgcaaaactggctatccgttg
tcggtgaaattgggaacaatatcgtccaacggagctgatgttttcagctacgacgaagac
gatttggtgaacgatccacaattggagaaacatttgaaacatttcggcattgatttggcg
gtgatggagaagacggaaaaatcgatgatcgaattggaattggatttcaatcagaaatgg
gaatttcacgaaattcaagaagaaggcaacaaactgaccccggtctacggtcccggctac
accggcatggtcaacatgggcaattcgtgctatttgaattccgtcatacaagcgttggtg
ataataccggacattgtacgagtctactgggacggtgcggatcgtatatttcaaaattgc
agcctggtcccctgtgacgatttcaacgtacaatttgcaaaagtagtatccggtctactg
tccggtcgttattccagagccgacatggaagacagaagaggtatacgcccggctgcgttt
cgtctgttgatcaaccgtggcaatgcggaatttgccagcaatcgccagcaggacgtcgaa
gaattcatgcgctacctgttcgaacgtctcgagcagaacaaacgaggcatcgactgtgtc
gaggatgtggtgagcgcgtggcgtttttcgttggaagaaaagctgacttgcctcgaatcg
ggcaacgtttcctacaagcaacgtcccgaagtgatactgtcacttccggttccgttggac
ttggaacaggagcaaatcgattcgacgacgttggtgaacgacgaaaatcgacctccgtct
gtgatgggtattctgcccgacgaaccggcacaattggcgatgatgaacggcgccgggggc
gtggctggggctggagtcgatagcagcggcggcggcagtggtgctggcaacgatgcgacg
gaaattgttgtcactagtagtagtaatagtggtgcagcaacagtggagaccggtgttatt
ggaccgaaattgcgtccaacggtgtcgttgatgaattgtttgaaagcgctggtcgagccg
gaattgttggacaacaccaagagtccattcaccggcagaatatctgcaatggaaaagcag
cttcattttaacacttttcctgattggttatggattcagatgaaaaagttcacatttgct
ccagattggcgaccgttgaaattggacgtgtcgattgcggtgcccgacttgttggatatg
aatgaattccgtggttcaggaccgcacgtgggaaaattgacaatggaatatacgaaagat
tcggacgatgaacagcagccgtctgccaaacccgaactggtgtctcagttgatcgatatg
ggctttgccgaatcggatgtacgaacagcgttgatcgagacggcgaacaatttggaaatt
gccgtccaatggctactcagcggcggtgtggacggtcagggcagcggtggcgctggcggc
ggcagctttaacagcaggctttccaacgatgcaccgtcgtcgactgaagtgcagttccgt
gacggcgacggcctgtaccgtcttcgaggattcatcagtcacattggcagttcagcgcac
actggtcattacgtttgtcacttgcttaaaggcgaccagtggataatttacaacgacgaa
aaagttgcgctctctgaaaagccgcccaaagatttgggctacgtatttctctacgaacgt
atatcaactaccgactga

DBGET integrated database retrieval system