KEGG   Trichinella spiralis: Tsp_11392Help
Entry
Tsp_11392         CDS       T01609                                 

Definition
(RefSeq) tropomyosin
  KO
K10373  
tropomyosin 1
Organism
tsp  Trichinella spiralis
Brite
Cytoskeleton proteins [BR:tsp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     Tsp_11392
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Tsp_11392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKIEKDNAMDRADAAEEKARQQQERVEKLEEELRDTQKKMMQVENELDKA
QEELTGANAQLEEKEKKVQEAEAEVAALNRRIQLLEEDFERAEERLKIATEKLEEASQTA
DESERVRKVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAE
ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRLLTQRLKEAETRAE
FAERSVQKLQKEVDRLEDELVHEKEKYKAISEELDQTFQELSGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaattaagaagaagatgcaagcgatgaagatcgagaaggataacgcgatggat
cgcgcagatgcggcagaggaaaaagcccgtcaacagcaggaacgcgtagaaaagcttgaa
gaagaactgcgtgatacacagaagaagatgatgcaagttgaaaacgagctcgacaaggcc
caagaagaactcaccggagccaatgctcaattggaagagaaagaaaagaaagtccaagaa
gcggaagctgaggttgcagcattgaaccgacgaattcagcttcttgaagaagatttcgaa
agagctgaagaacggctgaaaattgccactgaaaaactggaagaagcttcacagacagct
gatgaaagcgaaagagtacgcaaagttatggaaaatcgctcattgcaagatgaagaacgc
gtttatcagctagaagcgcagctcaaagaagctcagctgttagctgaagaagccgaccga
aaatatgacgaagtagctcgtaaacttgcaatggttgaagctgacttggaaagagctgaa
gaacgcgcagaagccggtgaaaacaaaattgtggaattggaagaggagctgcgtgttgtt
ggtaacaacttgaaatctttggaagttagcgaagagaaagctctgcaacgcgaagactca
tacgaagaacaaattcgattgttgactcaacgattgaaggaggctgagactcgagctgaa
tttgctgaacgttcagtgcagaaattgcaaaaggaagttgaccgattggaagacgagctg
gttcatgagaaagaaaaatacaaagcaatttctgaagaattggaccagactttccaagaa
ttatccggctactga

DBGET integrated database retrieval system