KEGG   Trichinella spiralis: Tsp_11392Help
Entry
Tsp_11392         CDS       T01609                                 

Definition
tropomyosin
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKIEKDNAMDRADAAEEKARQQQERVEKLEEELRDTQKKMMQVENELDKA
QEELTGANAQLEEKEKKVQEAEAEVAALNRRIQLLEEDFERAEERLKIATEKLEEASQTA
DESERVRKVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAE
ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRLLTQRLKEAETRAE
FAERSVQKLQKEVDRLEDELVHEKEKYKAISEELDQTFQELSGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaattaagaagaagatgcaagcgatgaagatcgagaaggataacgcgatggat
cgcgcagatgcggcagaggaaaaagcccgtcaacagcaggaacgcgtagaaaagcttgaa
gaagaactgcgtgatacacagaagaagatgatgcaagttgaaaacgagctcgacaaggcc
caagaagaactcaccggagccaatgctcaattggaagagaaagaaaagaaagtccaagaa
gcggaagctgaggttgcagcattgaaccgacgaattcagcttcttgaagaagatttcgaa
agagctgaagaacggctgaaaattgccactgaaaaactggaagaagcttcacagacagct
gatgaaagcgaaagagtacgcaaagttatggaaaatcgctcattgcaagatgaagaacgc
gtttatcagctagaagcgcagctcaaagaagctcagctgttagctgaagaagccgaccga
aaatatgacgaagtagctcgtaaacttgcaatggttgaagctgacttggaaagagctgaa
gaacgcgcagaagccggtgaaaacaaaattgtggaattggaagaggagctgcgtgttgtt
ggtaacaacttgaaatctttggaagttagcgaagagaaagctctgcaacgcgaagactca
tacgaagaacaaattcgattgttgactcaacgattgaaggaggctgagactcgagctgaa
tttgctgaacgttcagtgcagaaattgcaaaaggaagttgaccgattggaagacgagctg
gttcatgagaaagaaaaatacaaagcaatttctgaagaattggaccagactttccaagaa
ttatccggctactga

DBGET integrated database retrieval system