KEGG   Trichinella spiralis: Tsp_11412Help
Entry
Tsp_11412         CDS       T01609                                 

Definition
histone deacetylase Rpd3 protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tsp  Trichinella spiralis
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:tsp04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 459 aa AA seqDB search
MFAPCLPLIIARKFATITTVSEVGNFYYGQGHPMKPQRIRMANNLILNYGLYRHMEIYKP
TWATVDEIRQFHSEDYITFLESVHPENLMDYNKHMQRFNVGEDCPVFEASACKLNRRACD
IAINWAGGLHHAKKYEASGFCYVNDIVLAILSLLRHHQRILYVDIDCHHGDGVEEAFFTS
DRVMTVSFHKYGEYFPGTGDLKDVGAGRGKYYAVNFPLRDGITDDSYRSIFEPVITKVME
SFQPSLIVMQCGADSLTGDRLGCLNLTVKGTVVKGHGRCVDFIRRQNLPMLMLGGGGYTV
RNVARCWTYETSVAIGTEISNDLPYNDYFEYFGPDFKLHIPPSAITDQNSKEYLQDIQMK
LFENLRMLPCAPSAPIMPIPDDPLSHVKTEEDEEMKHADERLPASLCDKMIEQEGDFYTD
ESKGDAEEIDTTNMVLENLQQRSSDPLQSPPQKVKKEEN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgccatgcctgcctctgattatcgcaagaaaatttgctactattacgacagta
agcgaagtcggcaacttttactatggccaaggacatccgatgaagccgcaacgcatcaga
atggctaacaatttaattctgaattatggtctgtatcgtcacatggaaatttacaaaccg
acatgggccaccgttgatgaaattcgacaattccatagtgaagattacattacatttttg
gagagtgttcatccggaaaatttgatggactacaacaagcacatgcaacgcttcaacgtt
ggggaagactgtccagtttttgaggcaagtgcgtgcaaattgaatcgcagagcttgtgat
attgcaattaactgggctggaggacttcaccatgcgaaaaaatacgaagcatccggattt
tgttatgtgaacgacattgttctcgcaattttgagtttattgcgtcatcatcagcgtatt
ttgtacgtggatattgattgccatcatggggatggcgttgaagaagcgttttttacatct
gatcgcgtcatgacagtttcttttcacaaatacggagaatattttccaggaactggcgat
ttaaaggatgttggagcaggacgtggaaaatattatgctgtaaattttccacttcgtgat
ggcattactgacgactcatatcgcagcatatttgagccagtaatcactaaagttatggaa
tctttccagccaagcttgattgtgatgcaatgcggcgcagattctctgacaggcgatcga
ttaggttgtctgaatttgaccgtcaaaggtacagtggtaaagggacatggtcgatgtgtg
gatttcattcgaagacagaatttgccaatgctaatgcttggcggcggcggctacacagta
cgcaatgtcgctcgttgctggacttatgaaacgtccgtagcaattggcacagaaattagc
aatgatttaccctacaatgactactttgaatattttggtcctgatttcaagttgcacatt
ccaccgtcagctataactgatcaaaattcaaaggaatatttgcaagacatacagatgaag
cttttcgaaaatttgcgtatgctgccttgcgcaccgtcggcgccaataatgccaatacct
gatgatccattaagtcacgtgaaaactgaagaagatgaagaaatgaagcatgccgacgaa
cggcttccagctagcttatgtgataaaatgatagaacaagaaggtgacttttacaccgac
gaaagcaaaggcgatgcggaagaaattgatactactaacatggtattagaaaatctgcag
cagcgttcgtcagatccattgcagtctccgccacaaaaagtgaagaaagaagagaactga

DBGET integrated database retrieval system