KEGG   Trichinella spiralis: Tsp_11412Help
Entry
Tsp_11412         CDS       T01609                                 

Definition
(RefSeq) histone deacetylase Rpd3 protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tsp  Trichinella spiralis
Pathway
tsp04213  Longevity regulating pathway - multiple species
tsp04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Tsp_11412
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Tsp_11412
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Tsp_11412
Chromosome and associated proteins [BR:tsp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Tsp_11412
   HDAC complexes
    Sin3A-HDAC complex
     Tsp_11412
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Tsp_11412
  Chromatin remodeling factors
   NuRD complex
    Tsp_11412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 10901174
NCBI-ProteinID: XP_003372672
UniProt: E5SV00
Position
Unknown
AA seq 459 aa AA seqDB search
MFAPCLPLIIARKFATITTVSEVGNFYYGQGHPMKPQRIRMANNLILNYGLYRHMEIYKP
TWATVDEIRQFHSEDYITFLESVHPENLMDYNKHMQRFNVGEDCPVFEASACKLNRRACD
IAINWAGGLHHAKKYEASGFCYVNDIVLAILSLLRHHQRILYVDIDCHHGDGVEEAFFTS
DRVMTVSFHKYGEYFPGTGDLKDVGAGRGKYYAVNFPLRDGITDDSYRSIFEPVITKVME
SFQPSLIVMQCGADSLTGDRLGCLNLTVKGTVVKGHGRCVDFIRRQNLPMLMLGGGGYTV
RNVARCWTYETSVAIGTEISNDLPYNDYFEYFGPDFKLHIPPSAITDQNSKEYLQDIQMK
LFENLRMLPCAPSAPIMPIPDDPLSHVKTEEDEEMKHADERLPASLCDKMIEQEGDFYTD
ESKGDAEEIDTTNMVLENLQQRSSDPLQSPPQKVKKEEN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgccatgcctgcctctgattatcgcaagaaaatttgctactattacgacagta
agcgaagtcggcaacttttactatggccaaggacatccgatgaagccgcaacgcatcaga
atggctaacaatttaattctgaattatggtctgtatcgtcacatggaaatttacaaaccg
acatgggccaccgttgatgaaattcgacaattccatagtgaagattacattacatttttg
gagagtgttcatccggaaaatttgatggactacaacaagcacatgcaacgcttcaacgtt
ggggaagactgtccagtttttgaggcaagtgcgtgcaaattgaatcgcagagcttgtgat
attgcaattaactgggctggaggacttcaccatgcgaaaaaatacgaagcatccggattt
tgttatgtgaacgacattgttctcgcaattttgagtttattgcgtcatcatcagcgtatt
ttgtacgtggatattgattgccatcatggggatggcgttgaagaagcgttttttacatct
gatcgcgtcatgacagtttcttttcacaaatacggagaatattttccaggaactggcgat
ttaaaggatgttggagcaggacgtggaaaatattatgctgtaaattttccacttcgtgat
ggcattactgacgactcatatcgcagcatatttgagccagtaatcactaaagttatggaa
tctttccagccaagcttgattgtgatgcaatgcggcgcagattctctgacaggcgatcga
ttaggttgtctgaatttgaccgtcaaaggtacagtggtaaagggacatggtcgatgtgtg
gatttcattcgaagacagaatttgccaatgctaatgcttggcggcggcggctacacagta
cgcaatgtcgctcgttgctggacttatgaaacgtccgtagcaattggcacagaaattagc
aatgatttaccctacaatgactactttgaatattttggtcctgatttcaagttgcacatt
ccaccgtcagctataactgatcaaaattcaaaggaatatttgcaagacatacagatgaag
cttttcgaaaatttgcgtatgctgccttgcgcaccgtcggcgccaataatgccaatacct
gatgatccattaagtcacgtgaaaactgaagaagatgaagaaatgaagcatgccgacgaa
cggcttccagctagcttatgtgataaaatgatagaacaagaaggtgacttttacaccgac
gaaagcaaaggcgatgcggaagaaattgatactactaacatggtattagaaaatctgcag
cagcgttcgtcagatccattgcagtctccgccacaaaaagtgaagaaagaagagaactga

DBGET integrated database retrieval system