KEGG   Trichinella spiralis: Tsp_11658Help
Entry
Tsp_11658         CDS       T01609                                 

Definition
putative phorbol ester/diacylglycerol-binding protein unc-13
Orthology
K15293  
protein unc-13
Organism
tsp  Trichinella spiralis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1282 aa AA seqDB search
MAFIRTLLAIQYAEIPSHAKAPIRRSSYLYVTGVLFTVVSGLDWPAEFTKCSDSHPMVSP
QTSLESASTHTVKTEFGSKDESSVLIEEQPCDGLVHTASSQIGFSTEQPGSVRPTNDISA
SIKPSEENCLQPVNGSEMNLTSVNMEMSNAKKRWVTAFRRICEQLGPKESFLESSPKTYD
FYTSIDAMPNIALLKKKSVPLVSELKMRVYRKTLQALIYPISVSTPHNFQVWTATSPTYC
YECEGLLWGLARQGLRCSECGVKCHEKCKDLLSADCLQTVHFACRRVFDVDKKMHHEAMK
QVKQCILEGTAKWSAKIAITVICAQGLSAKDKTGKSDPYVTVQVGKVKKRTRTIHQELNP
FWSEKFYFECHNSTDRVKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDV
WYNLEKRTDKSAVSGAIRLQINVEIKGEEKVAPYHDQYTCLHEHIFNYYCSKEMGQLKLP
DARGDESWKVYFDETGQEIVDEFAMRYGIESIYQAMIHFACLCTKYMCQGVPAVISTLLA
NINAYYAHTTATSAVSASDRFAASNFGKDRFVKLLDQLHNSLRIDISMYRVLELTSPPRA
STVVRECATACIKSTYQFLFENCYELFQREFEGNQALTTNPELVGPSTDSVEFWHKMIAL
MISVIEEDRNIYTPVLNQFPQELNIGQLSAATMWSQYTIDLKLALEEHSEQRKCKSSDYM
NLYFKVKWFYNNYVADIPPYKGTIPEFPVYELFAIASLIFEYYIYFTCRWFIPFVMQWLN
ENDEISMDFLRGAFERDKKDNYPQSSEHTLFSNSVVDVFTQLNQGLDVLRKMDCPDPDVY
GDMMKRFSKTVNKVLLAYADMVQKDFSRYVGNEKLVKFDLKQACILMNNVQQLRVQLEKM
YESMGGAMLDQDAQQVLKGLQSKLNNVLESLTHVFAASLESNIYDSTVKLGNLLMRVKGG
GQVQKSQVTAEADLILEPLMDLLDVSLTQYAQQCEKTVLKKLLKELWRITISCMEKLVVL
PVFPDRNLLKQLPNAKIGDMSKLLSNHLKEVKNISSVKEVMDLARESDRSLTPKQCTVLD
ASLDTVKSYFHAGGSGLKKSFLEKSAEYQSLKYALSLYTQTTDQLIKTFIALQKEQVHIV
GPNQADKKRKFATKTKTNNWAPKFNEVFYFILGNEDELENYELIFQAKDYCFAREDRLIG
VGVLQLRSFAEHGSCACWVQLGRRQYIDDTGLILLRILSQRHYDEIAKQFVKLKTESRYE
SELHTTGSSFQLDKLSANSTAG
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttattcggactcttttggcgattcaatatgcagaaattccatctcacgcaaag
gctccaattcgtcgatcatcttacttgtatgttacgggtgttttgtttaccgttgtcagt
ggattggattggcctgctgaatttaccaaatgttctgacagtcatccgatggtgtcaccg
cagacgtcgttggaaagcgcctctacgcatacagtgaaaaccgaattcggctccaaagat
gaatccagtgttcttattgaagagcagccttgtgacgggttagtgcataccgcttcttct
cagatcggcttttctactgaacagcctggatcggttcgaccgaccaacgacatttctgct
agtattaaaccgtccgaagaaaattgcttgcaaccagtgaatggaagtgaaatgaattta
acgtcagtaaatatggaaatgtcgaatgcgaaaaaacgctgggtgactgcatttcgaaga
atttgcgaacaactaggaccaaaagaatcatttttggaaagtagtccgaaaacgtacgac
ttttacacgagcattgatgccatgcctaatattgcacttttgaagaaaaaatctgtgcct
ctagtcagtgaactgaaaatgcgcgtatatcggaaaacgcttcaagctttgatatatcca
atctcggtttcgacgccacacaattttcaagtctggactgccacgtcacctacgtattgt
tacgaatgtgaaggtttgctttggggtttggctagacaaggcttgcgttgttcagaatgt
ggtgtgaaatgtcacgaaaaatgcaaagatttgctcagcgctgattgtttgcaaactgta
cactttgcttgtaggcgtgtttttgacgtggataaaaagatgcatcacgaagcaatgaaa
caagtgaaacagtgcattttagagggaactgccaaatggtctgctaaaattgccataact
gtcatatgtgctcaaggtctcagtgcaaaagacaaaacgggtaaaagtgatccttacgtg
acggtgcaggttggtaaagtgaaaaaacgcaccagaaccatccatcaagaattgaatcca
ttttggagtgaaaaattttactttgaatgtcataattctactgatcgagtgaaagtacga
gtttgggatgaagataatgatttgaaaagcaagcttaggcaaaagttaactcgtgaatca
gatgatttcttgggccaaactattattgaagtgcgaactctgagtggagagatggatgtt
tggtacaatttagaaaaacgaactgataagtcagctgtaagtggtgcgatacggcttcaa
attaatgtcgaaataaaaggcgaagaaaaagtggcgccatatcacgatcagtatacgtgt
cttcatgagcatattttcaactattattgttcaaaagaaatgggtcaactgaagttacct
gacgccagaggggacgagtcgtggaaagtatattttgatgaaactggccaagaaattgtt
gatgaatttgcaatgcgttatggaattgaatcaatttaccaagctatgatccattttgct
tgtctttgtacgaaatatatgtgtcaaggtgtgcctgctgtgatcagtacactgttagcc
aatataaatgcttattatgctcatacgacggccacatctgccgtttctgcctcggacaga
tttgctgcatctaattttgggaaagatcgatttgtaaaacttttagatcaacttcacaat
tcgctcagaattgacatatcaatgtacagggtattggaacttactagtccaccgagggcg
tcaaccgtcgttcgtgagtgtgctacagcttgcattaagtcaacataccaatttttgttt
gaaaactgttacgaactgttccagcgtgaattcgaaggaaatcaagctttaactacaaat
ccagaacttgttggaccatcgacagattcagttgaattttggcataagatgatcgctttg
atgatttcagtcattgaagaagacagaaacatctacacgcctgttttaaatcaatttccg
caagaattaaacattggccagttgagcgctgcaacgatgtggagtcagtatacaatcgat
cttaaacttgctttagaagagcattcagaacaaagaaaatgcaaaagctccgactacatg
aatttgtatttcaaagttaaatggttttacaataattacgttgctgacattcctccttac
aaaggaacaataccagaatttcctgtgtatgaattatttgctattgcatcattaattttt
gaatattatatttactttacttgtaggtggtttattccgtttgtaatgcaatggttgaat
gaaaacgatgaaatttcaatggactttttacgtggtgcttttgaacgagataaaaaagat
aattatccgcagagcagtgagcatacactgtttagcaattctgttgttgatgtctttacc
cagctaaatcagggccttgacgtacttcgtaaaatggattgtcctgatccagatgtttac
ggtgatatgatgaaacgcttttcaaagactgttaacaaagtgctacttgcatacgccgac
atggtacagaaggattttagccgctacgttggcaatgaaaaattggtaaaatttgacttg
aaacaagcttgcattttgatgaacaacgtccaacaattgcgtgttcaattggaaaaaatg
tacgaaagtatgggtggtgcaatgttagatcaagacgctcaacaggtgctcaaaggactg
cagtcgaaattgaacaacgtattggagagtttaacgcatgtatttgctgcaagcttggaa
agtaatatttacgattcgacggtaaaattgggcaatttattaatgagagtgaaaggtggt
ggtcaagttcaaaagtcgcaagtcaccgctgaagcagatttaattctcgagccattgatg
gatctgcttgatgtttccttgactcaatatgctcagcagtgtgagaagactgtgttaaag
aagttgttaaaggaattatggcgaattaccattagctgtatggagaagctagtagtgctt
ccagtctttcctgatcgaaatctactcaagcagcttcccaatgccaaaataggggatatg
tctaaactgctttccaatcatttgaaagaagtgaaaaatatatcttcagtaaaagaggtg
atggatcttgctcgagaatcggatcgtagtttaactccaaagcagtgcactgttttggac
gcgtcacttgacactgtgaaaagttactttcatgctggtggaagcggtttgaagaaaagt
tttcttgaaaaatcagctgaatatcagagtctaaaatatgctttatctttgtacacgcaa
acaacagatcaattgatcaaaacgttcatcgcacttcagaaagaacaagtgcacatagtg
ggaccgaaccaagcggacaaaaaaaggaaatttgccacaaaaacgaaaacgaacaactgg
gctccaaaatttaatgaagttttttacttcattttgggaaatgaagatgaactggaaaat
tatgaacttatttttcaagcgaaagattattgctttgcgagggaagatcgacttattgga
gtcggagttttgcagttgcgcagctttgccgaacatggttcttgtgcttgttgggtacag
ctgggacgacgtcaatatatagatgatacgggcttgatattgcttcgtattctatcgcaa
aggcattacgatgaaattgctaaacaatttgtgaaattgaaaactgaatcacgttacgaa
agtgaattgcacaccactggtagctcttttcaactggataaattatccgcaaattcgaca
gccggctga

DBGET integrated database retrieval system