KEGG   Trichinella spiralis: Tsp_12759Help
Entry
Tsp_12759         CDS       T01609                                 

Definition
profilin-3
Orthology
K05759  
profilin
Organism
tsp  Trichinella spiralis
Brite
Exosome [BR:tsp04147]
 Exosomal proteins
  Proteins found in most exosomes
   Tsp_12759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 126 aa AA seqDB search
MSWNDLVQNNLIGTQCVSKAAICSLDGQIWGVSENFQLTQQEALAAANAFKNKEGIQANG
LKLEGKKYFVLQADDERIIGKRESSGFFVYKTASTIIISIYQDGIQPEQCSKHTGALADH
FRRTGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaacgatctcgttcaaaacaacctgattggcacgcagtgtgtctccaaagct
gctatatgttctttggatggccaaatttggggtgtgtcggaaaattttcagttgactcaa
caagaagcattagcggcagcgaatgcattcaaaaacaaagaaggcattcaagcaaacgga
ttaaagctcgaagggaaaaaatatttcgtcctacaagctgacgatgagcgtattattgga
aaacgtgaatcgagtggattttttgtttacaaaactgcttcgacaatcatcatatccatc
tatcaggatggaatccagccggagcagtgcagcaaacacactggggcattagctgatcat
tttcgtcgaaccggatattag

DBGET integrated database retrieval system