KEGG   Treponema succinifaciens: Tresu_0056Help
Entry
Tresu_0056        CDS       T01461                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
tsu  Treponema succinifaciens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tresu_0056
DNA repair and recombination proteins [BR:tsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tresu_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
63701..64288
Genome map
AA seq 195 aa AA seqDB search
MNALDELTESFSRLPGIGKKSAARIASHLLKTDSSFNIRFSNQILSLQERIKPCSICGAW
TEEDPCPICSDIARDKTILCVVEQPQDVATIESSHEFHGLFHVLGGVISPLEGITPDKLR
ISQLLERVKLGVIKEVIIATNPTVEGDTTALFIQRVLQDTQVVVTRLASGLPAGGDLEYA
DRLTLARSFQGRVKI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcttgacgagttgacagaaagtttttcaaggcttcctggaatcggaaaaaaa
tctgcggctagaattgcaagccatcttttaaagaccgacagttcttttaatatccgtttt
tcaaatcaaattttgtcgttgcaggaaagaataaaaccttgttctatttgcggcgcctgg
acagaagaagatccctgccctatttgttccgacattgcaagagataaaacaattctttgt
gttgttgagcagccacaggacgttgcgacaattgaaagttctcatgaattccacggattg
tttcatgttttgggcggagttatttctcctcttgaaggaattacgccggacaagcttaga
atttcacagctgcttgagcgtgtaaagcttggtgttataaaagaagtcattattgcaacg
aatcccactgttgaaggcgatacaacagctctttttatacagcgcgttttgcaagacact
caagttgttgttacgcggcttgcttctggacttccggctggaggagatttggaatatgcg
gaccggcttacattggcaagaagttttcagggacgcgttaaaatttag

DBGET integrated database retrieval system