KEGG   Treponema succinifaciens: Tresu_0056Help
Entry
Tresu_0056        CDS       T01461                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
tsu  Treponema succinifaciens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tsu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
63701..64288
Genome map
AA seq 195 aa AA seqDB search
MNALDELTESFSRLPGIGKKSAARIASHLLKTDSSFNIRFSNQILSLQERIKPCSICGAW
TEEDPCPICSDIARDKTILCVVEQPQDVATIESSHEFHGLFHVLGGVISPLEGITPDKLR
ISQLLERVKLGVIKEVIIATNPTVEGDTTALFIQRVLQDTQVVVTRLASGLPAGGDLEYA
DRLTLARSFQGRVKI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcttgacgagttgacagaaagtttttcaaggcttcctggaatcggaaaaaaa
tctgcggctagaattgcaagccatcttttaaagaccgacagttcttttaatatccgtttt
tcaaatcaaattttgtcgttgcaggaaagaataaaaccttgttctatttgcggcgcctgg
acagaagaagatccctgccctatttgttccgacattgcaagagataaaacaattctttgt
gttgttgagcagccacaggacgttgcgacaattgaaagttctcatgaattccacggattg
tttcatgttttgggcggagttatttctcctcttgaaggaattacgccggacaagcttaga
atttcacagctgcttgagcgtgtaaagcttggtgttataaaagaagtcattattgcaacg
aatcccactgttgaaggcgatacaacagctctttttatacagcgcgttttgcaagacact
caagttgttgttacgcggcttgcttctggacttccggctggaggagatttggaatatgcg
gaccggcttacattggcaagaagttttcagggacgcgttaaaatttag

DBGET integrated database retrieval system