KEGG   Treponema succinifaciens: Tresu_0121Help
Entry
Tresu_0121        CDS       T01461                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tsu  Treponema succinifaciens
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tresu_0121
   00670 One carbon pool by folate
    Tresu_0121
Enzymes [BR:tsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Tresu_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
130579..131133
Genome map
AA seq 184 aa AA seqDB search
MNAIYASGLNGEFALEDGTLPWKKNSLLQKECKEDMDFFKHMTAKKAVIMGFNTFKTLPF
PLKNRLNIVIKRNAAPQKIERIDNEFFFFSSIEKALNALDFLCPDDIFLIGGKKLFTEAF
NKNLVDGIVYETVFCRNFPDAKIFINCPENFSLIDSRKSGILVFNQYKNPEAPKAQFQSG
LQNP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaatttacgcctcaggacttaacggagaattcgcgctagaagacggaacactt
ccatggaaaaaaaactctttgcttcaaaaagaatgcaaagaagacatggatttcttcaaa
catatgaccgcaaaaaaagccgtcataatgggattcaatacatttaagactctgcccttt
ccgcttaaaaacaggctgaacattgtaataaaaagaaacgccgccccgcaaaaaatagaa
cgcatagacaatgaatttttctttttttcttctatagaaaaagctttaaatgcgcttgat
tttctttgcccggacgatatttttttaatcggcggaaaaaaactttttacagaagcgttc
aacaaaaatcttgtagacggtattgtttatgaaacagttttttgcaggaattttccagac
gcaaaaatttttataaattgcccggaaaatttcagcctgatagattcaaggaaaagcgga
attcttgtttttaatcagtacaaaaatccggaagctccaaaggctcaattccaaagcggc
ttgcaaaatccctag

DBGET integrated database retrieval system