KEGG   Treponema succinifaciens: Tresu_0170Help
Entry
Tresu_0170        CDS       T01461                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tsu  Treponema succinifaciens
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tresu_0170
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tresu_0170
Enzymes [BR:tsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Tresu_0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
181090..182373
Genome map
AA seq 427 aa AA seqDB search
MYEYRIEGGFPIKGTIKASGNKNAALPCIAASLLTSEKVILRNIPEIEDTGVMLLILQSF
GAKVEKLSENAWEINASEISRNDIPPELSKKIRASILFAGPLLARTGKAIMPPPGGDVIG
RRRLDTHFLALEELGARVSIDRKFEFSANKLVGSDIFLDETSVTATENAVMAAVLAEGST
EITNAASEPHVQDLCNMLNAMGAKISGVGSNILKIEGVKKLKGCDFSIGPDFMEIGSFIG
LAAATHGSIKIEGIRVNDLRPLRISFNKLGIRWDIEEDVLTVSADQEMKVNTDLGGMIPK
IDDSPWPGFPPDLTSIMTVVATQVEGTVLIFEKMFESRMFFVDKLISMGARITLCDPHRA
VVAGPSSLHGEHLVSPDVRAGMAMVIAALCARGESRISNVYQIERGYENLVERLKSLGAH
IEKIDVA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatatagaatagaaggcggttttccgataaagggaactataaaagcaagcgga
aacaaaaatgcggctcttccttgcattgcggcttccttgcttacttccgaaaaagttatt
ttacgaaatattccagaaattgaagatacaggcgttatgcttttgatcttgcagtcgttt
ggcgcaaaagttgaaaagctttctgaaaatgcgtgggaaataaatgcttctgaaatatca
cgcaatgatattcctcccgagcttagcaagaaaatccgcgcttcaattctttttgcagga
cctttgcttgcccgcactggaaaagctataatgccgcctcctggtggagatgtcattggc
cgccgccgtcttgacactcattttcttgcgcttgaggagcttggcgcgcgtgtttcaata
gatagaaaatttgagttcagcgcgaataagcttgttggctctgatattttccttgacgaa
acttctgttactgccacagaaaatgctgttatggcggctgttcttgcagaaggttcaaca
gaaattacaaatgcggctagcgagcctcatgttcaggatttatgcaatatgctgaatgca
atgggcgcaaaaatttcaggagtcggatcaaatattttaaagattgaaggtgttaaaaaa
ctcaagggctgcgatttttcgattggtccggattttatggaaataggttcgttcattgga
cttgctgccgccactcatggctctataaagattgaaggaatccgtgtaaatgatttgcgt
ccgctgcggatttcttttaataaacttggaatccgctgggatattgaagaagatgttctt
acagtttctgcagatcaggaaatgaaagtgaacacagatttaggcggaatgattccaaaa
attgatgacagtccttggccgggatttccgccggatttaacttcgattatgacagttgtt
gcaacccaggttgagggaactgttttgatttttgaaaaaatgtttgaaagccgaatgttc
tttgtggacaagcttataagcatgggcgcgcgcattacactttgcgatcctcaccgtgca
gttgtcgctggtccaagttctcttcatggcgagcatcttgtttctcctgatgtccgtgct
ggaatggcaatggttattgcggctctttgcgcccgtggagaaagccggattagcaatgtg
tatcagattgaacgcggctacgaaaaccttgtggaacgcttaaaatcccttggcgcgcat
atagaaaaaatagatgtcgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system