KEGG   Treponema succinifaciens: Tresu_0342Help
Entry
Tresu_0342        CDS       T01461                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tsu  Treponema succinifaciens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tresu_0342
   01230 Biosynthesis of amino acids
    Tresu_0342
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tresu_0342
   00030 Pentose phosphate pathway
    Tresu_0342
   00051 Fructose and mannose metabolism
    Tresu_0342
   00052 Galactose metabolism
    Tresu_0342
  Energy metabolism
   00680 Methane metabolism
    Tresu_0342
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tresu_0342
Enzymes [BR:tsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tresu_0342
Protein phosphatases and associated proteins [BR:tsu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tresu_0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
367520..368602
Genome map
AA seq 360 aa AA seqDB search
MECKVKRFGILTSGGDAPGLNAAIRALCRAAKNQYNMEAVGIFNGYRGLINGDMKVLSEN
ELSGLIAQGGTILGTSREKPFKNPVVNEATGLLPVEAIKENYKKWNLDALVCIGGNGTNT
TASLLFQSGLNVIGLPKTIDNDIEGSDVTFGFYTALDVATDAIDRIHTTACSHGRVMIVE
IMGHKAGWLGLYSGIAGGGDAILIPEIPYDINSVAKKIKERKSSGKNFSIVVVAEGAKSK
EESLLDKKSFKKARAVMQCTIGARVAKELEEATGFECRATVVGYLQRGGTPSPYDRLLST
QIGAAAADFIAQEKFGNLVAVQNGKIKPVPLDYVAGKVKNIPLDHPMIKTARDLGICLGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcaaggtaaaaagatttggaattcttacaagtggcggagatgcgcctggactt
aatgctgcgataagggctttgtgccgtgccgcaaaaaatcagtataatatggaagctgtg
ggaattttcaacggctaccgcggacttataaatggcgacatgaaggttctttcagaaaat
gagctttctggtcttatagctcaaggcggaacaattcttggaacttcaagagaaaagcct
tttaaaaatccagttgtaaatgaagcgaccggtcttttgcctgttgaagccataaaagaa
aactacaaaaaatggaatcttgacgctcttgtttgtatcggtggaaacggaacaaataca
actgcaagccttttgtttcagtctggcttgaatgtaattggacttccaaaaacaattgac
aacgatattgaaggctctgacgtaacattcggattttatacagcattggatgttgcaact
gatgctattgatagaattcacactacagcctgtagccacggcagagttatgattgttgaa
atcatggggcacaaagccggctggcttggactttattcaggaatcgcaggcggcggagat
gctattttgattccggaaattccttacgacataaatagcgttgcaaaaaaaataaaggaa
cgcaaatcttctggaaagaatttttcaattgttgttgttgcggaaggcgcaaaatcaaaa
gaagaatccttgcttgacaaaaaatcttttaaaaaggcacgggcggtaatgcaatgtacc
ataggcgcaagagttgcaaaggagcttgaagaagcaactggatttgaatgccgtgcaact
gttgttggctacttgcagcgcggaggcacaccttctccttatgaccgtcttctttccaca
cagattggagctgcagccgctgattttattgctcaggaaaaattcggaaatcttgttgcg
gttcagaatggaaaaataaagccggttccacttgactacgttgctggaaaagtaaaaaat
attccgcttgatcatcctatgataaaaactgccagagacttgggtatttgccttggagac
tga

DBGET integrated database retrieval system