KEGG   Treponema succinifaciens: Tresu_0477Help
Entry
Tresu_0477        CDS       T01461                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tsu  Treponema succinifaciens
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tresu_0477
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tresu_0477
Enzymes [BR:tsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Tresu_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523539..525245
Genome map
AA seq 568 aa AA seqDB search
MEKNLCVLLKSLGSEETDYKIVAEDGISSPKNTDACVEGLAFDSRDVKENYLFFALPGTH
TTGNKFIAQAVSCGAGAVVFQDEITQEEHSQIKEALASSSKKVVFVKVPSSRFAMSPVSS
CFYDNPSSKLVVYGVTGTEGKSSTVSFIWQLLRLNGIKAGFISTVQYSLGGDAIDNPQHQ
TTPEAPVVQRELYEMVCNGCTHAVVESSSHGLSKKLNRLGNVLFDCAVFMNVTLEHLEFH
GTYEQYKSDKANLFRALDLHNHEKTIAGVATKIPAFGVVNLEDPAASYFASCTKHKTIGF
TTEGKAGKQAALGLSSPPLPEIPKDMPYFSCRNIASARFGLAFSIHRFETHDSLNNENSV
VHVKASVPGAFNAYNITAAILAVHGTTGISIEKLALCAQKLTSVKGRMTVIDEGQPFEVI
VDYAHTPSSFETIFPPLKNRAMGKMICVFGSGGERDTTKRPLQGEIAARFCDIVILTDED
PRKEDRMTIIEQIALGARKEGKKDNVDLFLVPDRPQAIRKAFSMAKENDIVLLLGKSHEN
SIIYADNAIKYDEISEAKNALKEMGFAK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaatttgtgcgtgcttttgaagtcgcttggctcggaagaaactgattataag
attgtggcggaagacggaatttcttccccaaagaatacagatgcttgtgtagaaggtctt
gcttttgacagccgggatgtaaaagaaaactatttgttttttgccttgcccggaactcat
acaacaggcaacaagtttatagcgcaggctgtttcttgcggggctggcgcagttgttttt
caggatgaaattacgcaggaagagcattcgcaaatcaaggaggctttggcttcctcttca
aaaaaggttgtgtttgtaaaagttccttcatcacgatttgcaatgtcgcctgtaagctcg
tgcttttatgataatccttcttcaaagcttgttgtctacggagttacaggaacggaaggc
aagtcttccactgtttcgtttatatggcagctcttgcgcctgaacggaatcaaggcgggt
tttatttccacagtgcagtattctcttggaggagacgctatagacaatccgcagcaccag
acaacgccggaagctcctgttgttcagcgcgagctttatgagatggtttgcaacggatgt
actcacgctgttgtggaatcttccagccacggattgagcaaaaaacttaacaggcttggc
aatgttctttttgactgcgctgtttttatgaatgttacgcttgagcatttggaattccac
ggaacttacgagcagtacaaaagcgacaaggcgaacttgttccgcgctttggatttgcat
aatcacgaaaaaacaattgccggagttgcgacaaaaattcctgcgttcggagttgtgaat
ttggaagatcctgcggcgtcttattttgcttcctgcaccaagcacaaaaccatagggttc
actacggaaggaaaagcaggcaagcaggctgctttgggactttcatctcctccgcttcca
gaaattccaaaagatatgccgtacttttcttgcagaaatatagcttcggcaagattcggg
cttgcattcagcattcaccgctttgaaacacacgattcccttaacaacgaaaattctgtt
gtccatgtaaaggcttctgttcctggagcgttcaatgcatacaatataacggctgcgatt
ttggctgtgcacggaacgaccggcatttcaatagaaaaacttgctttgtgtgcgcagaaa
cttacgagtgtaaaaggccgcatgactgtaattgacgaaggtcagccttttgaagtgatt
gtggactatgcccatacgccttcgagttttgaaacgatttttccgcctttaaaaaaccgc
gctatgggcaagatgatttgcgtgttcggctctggcggtgaacgcgacacaacaaaacgt
cctcttcaaggtgaaattgccgcccgcttctgcgacattgtgattcttacagatgaagat
ccgcgcaaggaagacagaatgacgattattgagcagattgctttgggtgcaagaaaagaa
ggcaaaaaagacaacgtggatttgttccttgttccagaccgtccgcaggcaatcagaaaa
gcgttcagcatggcaaaggaaaacgacattgtgcttctgcttggaaaaagccatgaaaat
tctataatttacgccgacaatgctataaagtacgatgaaatttcagaagcaaagaatgct
ttaaaagaaatggggtttgcaaaatga

DBGET integrated database retrieval system