KEGG   Treponema succinifaciens: Tresu_0484Help
Entry
Tresu_0484        CDS       T01461                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tsu  Treponema succinifaciens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tresu_0484
Enzymes [BR:tsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Tresu_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531583..533601
Genome map
AA seq 672 aa AA seqDB search
MKKRTGVVVPLSALYTKDSAACGDFLALKNLADFCEKAGFSVVQLLPVNDTGTQSSPYSG
LSAFALHPLFIRINALPEFEAALKGCKQFASAYKNFEKNFTYKRRFDYDAVVNEKNQLLH
LLYNYIEKTSAKSENESMQKLPAQMEKFIRANNWIIPYAVFKNIKDENMQASWKSWDEQV
RNVSREKIMLKWNNKAKKSSHNFFVWCQMRASEQFKESAEYLRSKGIILKGDIPILMNED
SVDCWTYPEFFRQDLRAGSPPDGENPLGQNWGFPTYDWERLEADGFAWWKDRIKVSSQYY
DAFRIDHVLGFFRIWAAKETETTAYLGHTVPYSDFSRKDLNDLGFSDDRIKWISEPHIPT
GLIENITWNHDEAVAFLEQVCDRVNNEELWNFKKEISGDKEIYSKKFCDDERKDSAVKNA
LAEKWRDRSLIQIKKDRFIKVFTFEKSSAWKTLSWDEQEKLKNLFARTEEKENGLWKQQA
LSTLGAIVHASDMIPCAEDLGVNLKVMPEVLQKLEILSLKVVRWCREWEKNGQPYIPFDQ
YPALSVATTSVHDSSTLRQWWNSEKDSVRAFLSACKTENCPDSNSAFTPDIAEFILKTVA
KCASLLLINPLQDYLFLEHCFYLENENDERINVPGSVNSFNWTYRIPVSIEEMSENKSLL
NKIKTVVQLHDN
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaaccggtgttgtagttccgctttctgcattgtacacaaaagacagcgca
gcctgcggagattttcttgcattgaaaaatcttgctgacttctgcgaaaaggcgggattt
tctgttgttcagcttcttcctgtgaacgatacggggactcagtcttcgccttattctggg
ctttctgcgtttgcgcttcatccgctttttataagaatcaatgcgctgccggaatttgaa
gcggctttaaaggggtgcaagcagtttgcttcggcatacaaaaattttgaaaagaatttt
acatataagcggcggtttgactatgacgctgttgtgaatgaaaaaaatcagcttttgcat
cttttgtacaattatatagaaaaaacttctgcaaaatcagaaaacgaatctatgcagaaa
cttccggcgcaaatggaaaagtttatccgcgcaaacaactggattattccttatgcggtt
ttcaagaacataaaagacgaaaatatgcaggcttcctggaaaagctgggacgagcaagtg
cgcaacgtaagccgcgaaaaaatcatgctcaaatggaataacaaggcaaaaaaatccagc
cacaatttctttgtctggtgccagatgcgtgcaagcgagcagtttaaagaaagcgcggaa
tatcttcgctcaaaaggaataattttaaaaggcgacattccaattttgatgaacgaggac
agcgttgactgctggacttatcctgaattctttaggcaggacttgcgcgctggttctccg
ccagatggagaaaatccgcttgggcaaaactggggatttccgacttatgactgggagcgg
cttgaagcagacggatttgcctggtggaaagacagaataaaagtttcatctcaatattat
gacgcattccgcattgaccacgttctaggcttttttagaatttgggctgcgaaagaaact
gaaacaaccgcttatcttggacacacagttccgtattcggatttttcaagaaaggacttg
aacgatttgggattttctgatgacagaataaagtggatttctgaaccgcacattccgacc
gggcttattgaaaatataacttggaaccatgacgaggctgttgcgttccttgagcaggtt
tgcgaccgtgtgaacaacgaggagctttggaactttaaaaaagaaatttctggtgacaag
gaaatttattccaagaaattttgcgatgacgagcgcaaagattccgcagtgaaaaatgct
cttgctgaaaaatggcgcgaccgttcattgattcagataaaaaaagacagattcataaaa
gtctttacgtttgaaaaatcttcagcctggaaaactttaagctgggacgagcaggaaaaa
ctgaaaaatctttttgcccggacagaagaaaaagaaaacgggctttggaagcagcaggct
ctttctactttgggcgctattgtccatgcttctgacatgattccttgcgcggaagatctg
ggcgttaatttaaaagttatgccggaagttcttcaaaaacttgaaattctttcgcttaaa
gttgtgcgctggtgccgcgaatgggaaaaaaacggacagccttatattccgtttgaccag
tatccagctttgagcgttgctacaacttccgtgcatgacagttcaactttgcgccaatgg
tggaattctgaaaaagacagcgtaagagcatttttgtctgcgtgcaaaactgaaaactgt
cctgattcgaattctgcctttactcctgacattgcggaatttattttgaaaactgttgca
aagtgcgcaagcttgcttcttataaatccgcttcaggattatttgttccttgagcattgt
ttttaccttgaaaatgaaaatgacgagcgcatcaatgttccgggcagcgtaaacagtttt
aactggacttataggattcctgtttctattgaagaaatgtctgaaaacaagtctttgttg
aacaagataaaaactgtagttcagctgcacgacaactaa

DBGET integrated database retrieval system