KEGG   Treponema succinifaciens: Tresu_0595Help
Entry
Tresu_0595        CDS       T01461                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tsu  Treponema succinifaciens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tresu_0595
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tresu_0595
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tresu_0595
Enzymes [BR:tsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tresu_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(651491..652876)
Genome map
AA seq 461 aa AA seqDB search
MDTKKIPYKIYLNEEEMPQFWYNMRADMKNKPAPLLNPGTLKPCTAEELEHVFCRELVKQ
ELNETDRYIPIPQEILDFYKMYRPSPLTRAYCLEKKLGTPAKIYYKFEGNNTSGSHKLNS
AIAQAFYAKEQGLKGVTTETGAGQWGTAMSMACAYLGLDCRVYQVRCSYEQKPHRREVIR
TYGAQAIPSPSMETEIGRKINAEYPGCTGSLGCAISEAVEYATKHDGYRYVLGSVLSQVL
LHQSIIGMEAKAAMDKYGIKPDVIIGCAGGGSNLGGLISPFMGEKLRGEKDYQFIAIEPA
SCPSLTRGVFAYDFCDTGEVCPMQKMYTLGSQFMPSANHAGGLRYHGMSAIVSQLYHDGY
IEARSVGQTEVFKAAELFCRSEGTLPAPESSHAIKVAIDEALKCKETGEEKTILFGLTGT
GYFDMKAYEAFNNGTMSDYIPTDEEIKKATDLIPRFPGNEF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaagaaaatcccttacaaaatctacttgaacgaagaagagatgccacagttc
tggtacaatatgcgcgccgacatgaagaacaagcctgctccgcttttaaatccgggaacg
ctaaagccttgcactgcggaagagcttgagcacgttttctgcagggagcttgtaaagcag
gagctgaacgaaaccgaccgctacattccgattcctcaggaaattctggacttctacaag
atgtaccgtccttctccgcttacaagggcttactgccttgaaaagaagctcggaacgccg
gcaaaaatctactacaagtttgaaggaaacaatacatcaggaagccacaagctgaactcg
gcaatcgcccaggcattctacgcaaaggagcagggactaaagggcgttactacggaaaca
ggagccggccagtggggaaccgctatgtccatggcgtgcgcatatcttggtctggactgc
cgcgtttatcaggttcggtgttcctatgaacagaagcctcatcgccgcgaggtaatcaga
acttacggagcgcaggcgattccttctccaagcatggaaactgaaataggaagaaagatt
aacgccgaatatccgggatgcaccggctctttgggctgcgcgatttcggaagcggtggaa
tacgccacaaagcatgacggctacagatacgttcttggctcggtcttgagccaggttctg
cttcaccagtcgataatcggaatggaagcaaaggccgcgatggacaagtatggaatcaag
ccggacgtaataataggatgcgccggcggcggctcgaatttgggcggacttataagcccg
ttcatgggagaaaaactgcgcggtgaaaaggactaccagttcatcgcgattgagcctgca
tcttgcccaagccttacgcgcggagtgttcgcctacgacttctgcgacacaggcgaggtc
tgcccgatgcagaaaatgtacacgctcggctcgcagttcatgccaagcgcaaaccacgcg
ggaggactccgctaccacggaatgagcgcgattgtaagccagctctaccacgacggctac
attgaggcaagaagcgttgggcagacggaagttttcaaggcggctgagcttttctgccgt
tcggaaggaactttgccggcaccggaatcaagccacgcaatcaaggttgcaatcgacgaa
gctttaaaatgcaaggaaaccggcgaagaaaagacaatcctgttcggtcttacaggaaca
ggctactttgatatgaaagcctacgaagcgttcaacaacggaacgatgagcgactacatt
ccgaccgatgaggaaataaaaaaagctacagatttgattccgcgctttccgggaaacgaa
ttctag

DBGET integrated database retrieval system