KEGG   Treponema succinifaciens: Tresu_0595Help
Entry
Tresu_0595        CDS       T01461                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00260  Glycine, serine and threonine metabolism
tsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01130  Biosynthesis of antibiotics
tsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tresu_0595
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tresu_0595
Enzymes [BR:tsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tresu_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Pribosyltran
Motif
Other DBs
NCBI-ProteinID: AEB13536
UniProt: F2NUH3
Position
complement(651491..652876)
Genome map
AA seq 461 aa AA seqDB search
MDTKKIPYKIYLNEEEMPQFWYNMRADMKNKPAPLLNPGTLKPCTAEELEHVFCRELVKQ
ELNETDRYIPIPQEILDFYKMYRPSPLTRAYCLEKKLGTPAKIYYKFEGNNTSGSHKLNS
AIAQAFYAKEQGLKGVTTETGAGQWGTAMSMACAYLGLDCRVYQVRCSYEQKPHRREVIR
TYGAQAIPSPSMETEIGRKINAEYPGCTGSLGCAISEAVEYATKHDGYRYVLGSVLSQVL
LHQSIIGMEAKAAMDKYGIKPDVIIGCAGGGSNLGGLISPFMGEKLRGEKDYQFIAIEPA
SCPSLTRGVFAYDFCDTGEVCPMQKMYTLGSQFMPSANHAGGLRYHGMSAIVSQLYHDGY
IEARSVGQTEVFKAAELFCRSEGTLPAPESSHAIKVAIDEALKCKETGEEKTILFGLTGT
GYFDMKAYEAFNNGTMSDYIPTDEEIKKATDLIPRFPGNEF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaagaaaatcccttacaaaatctacttgaacgaagaagagatgccacagttc
tggtacaatatgcgcgccgacatgaagaacaagcctgctccgcttttaaatccgggaacg
ctaaagccttgcactgcggaagagcttgagcacgttttctgcagggagcttgtaaagcag
gagctgaacgaaaccgaccgctacattccgattcctcaggaaattctggacttctacaag
atgtaccgtccttctccgcttacaagggcttactgccttgaaaagaagctcggaacgccg
gcaaaaatctactacaagtttgaaggaaacaatacatcaggaagccacaagctgaactcg
gcaatcgcccaggcattctacgcaaaggagcagggactaaagggcgttactacggaaaca
ggagccggccagtggggaaccgctatgtccatggcgtgcgcatatcttggtctggactgc
cgcgtttatcaggttcggtgttcctatgaacagaagcctcatcgccgcgaggtaatcaga
acttacggagcgcaggcgattccttctccaagcatggaaactgaaataggaagaaagatt
aacgccgaatatccgggatgcaccggctctttgggctgcgcgatttcggaagcggtggaa
tacgccacaaagcatgacggctacagatacgttcttggctcggtcttgagccaggttctg
cttcaccagtcgataatcggaatggaagcaaaggccgcgatggacaagtatggaatcaag
ccggacgtaataataggatgcgccggcggcggctcgaatttgggcggacttataagcccg
ttcatgggagaaaaactgcgcggtgaaaaggactaccagttcatcgcgattgagcctgca
tcttgcccaagccttacgcgcggagtgttcgcctacgacttctgcgacacaggcgaggtc
tgcccgatgcagaaaatgtacacgctcggctcgcagttcatgccaagcgcaaaccacgcg
ggaggactccgctaccacggaatgagcgcgattgtaagccagctctaccacgacggctac
attgaggcaagaagcgttgggcagacggaagttttcaaggcggctgagcttttctgccgt
tcggaaggaactttgccggcaccggaatcaagccacgcaatcaaggttgcaatcgacgaa
gctttaaaatgcaaggaaaccggcgaagaaaagacaatcctgttcggtcttacaggaaca
ggctactttgatatgaaagcctacgaagcgttcaacaacggaacgatgagcgactacatt
ccgaccgatgaggaaataaaaaaagctacagatttgattccgcgctttccgggaaacgaa
ttctag

DBGET integrated database retrieval system