KEGG   Treponema succinifaciens: Tresu_0818Help
Entry
Tresu_0818        CDS       T01461                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tsu  Treponema succinifaciens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tsu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:tsu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
862840..864525
Genome map
AA seq 561 aa AA seqDB search
MKLKVVAFFFCSVIFTVAFADSAKIDFWSDIPPEPLSKKLVESMGDEELLAQILMFGWAG
AEPSDLLNSWVIQRGLGSVKVFGWNTDNIQKVAKSVRILQQEAASRSLKIPLFVATDQEG
GWIRHVKGETSDTPGNLAIGASGYPLDAYYSGFYINREIRALGINMNFAPTVDLYTNLNS
SVIGPRSFGSDPVDSGILGEAFAAGSMDAGVIPTAKHFPGHGDTSLDSHGRLPQIEIDAR
TLVNRELVPFEYLIKAKIPAIMSGHLSFPQIESDGTPASLSKKFLTDILRRQMNYDGLII
TDDMMMNGATLFAGSFHRAVMMAIEAGNDIIISSTTAGLYDNMWTRNLERMRTNSEFKER
VKDAARRVIFTKLNYFKSENHAPLYPDENSIFEHIPDKDGQKFFLEQACRSVSVYKQGTA
FPLKPAEGERVLIAGPFLALYSEGRKRYPNVSTFHFSYELKNDNSNFDNWNAASLVSVAD
SYDTIIICVYDKHTANIAKRLRYMDKRVVILSIMSPVFVLDDFDWADTILCGYSYSGYSF
AALFGALSGEFIPQGIVPLKH
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaagttgtagcattttttttctgttcagtaatttttacagttgcctttgct
gattctgcaaaaatagatttttggagcgacattccgcctgagcctctttctaaaaagctt
gttgaatccatgggcgatgaagagcttcttgcgcagattcttatgttcggatgggcaggg
gcagagcctagcgacttgctgaattcctgggtgattcagcgcgggcttggaagtgtaaaa
gtttttggctggaatactgacaatattcagaaagtggcaaagtcagtgcggattcttcag
caggaagctgcaagcaggtctttaaaaattccgctgtttgttgctacagaccaagaagga
ggctggattcgccatgtaaaaggtgaaacttctgataccccggggaatcttgcgattgga
gcttccggttatcctttggatgcttattattccggcttttatataaaccgcgaaatccgc
gcgcttggaattaacatgaattttgctccgactgtggatttatatacaaatttgaattca
agcgtaatcggtccgcgctcttttggctctgatcctgttgattctggaattttgggtgaa
gcttttgcggcaggctctatggacgctggtgttattccgactgcaaaacattttccggga
catggagatacaagccttgacagccacggaaggcttccgcagattgaaattgatgcgcgg
actttggtgaaccgtgagcttgttccgtttgaatatttgataaaggcgaaaattcctgca
ataatgagcgggcatctttcatttccgcagattgaaagcgatggaactcctgcaagcctt
tcaaaaaaatttctaactgatattttgcgccgccagatgaattacgatggccttataatt
actgatgacatgatgatgaacggagctactttgtttgccggctcctttcatcgtgccgtg
atgatggcgatcgaggctggaaacgacattataatttcttccacgactgccggactttat
gacaatatgtggacgcgcaatcttgagcggatgagaacaaattcagaatttaaagaacgt
gtaaaagatgccgcccgtcgcgttatttttaccaagctgaattattttaaaagtgaaaac
catgcgccgctttatcctgatgagaattcaatttttgagcacattcctgataaggacggt
cagaaatttttccttgagcaagcttgccgttccgtgagcgtttacaagcaaggcactgct
tttccattgaagcctgctgaaggtgagcgggttttaatagcaggaccttttcttgcgctt
tatagtgaaggccgaaagcgttatccaaatgtttcaacttttcactttagttatgaactg
aaaaacgacaacagcaattttgataattggaatgcagcctctttggtttccgtggctgat
agctatgacacaattattatttgtgtttatgacaagcacacggcgaatattgctaaacgt
ttgcggtacatggacaagcgtgttgtcattctttcgattatgtcgccggtttttgttcta
gatgattttgactgggcggacacgattctctgcggatacagctactcaggttattcgttt
gcggctttgtttggagctttgagcggagaatttattccgcagggaattgttccgttgaag
cactaa

DBGET integrated database retrieval system