KEGG   Treponema succinifaciens: Tresu_0969Help
Entry
Tresu_0969        CDS       T01461                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tsu  Treponema succinifaciens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tresu_0969
   01230 Biosynthesis of amino acids
    Tresu_0969
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tresu_0969
   00051 Fructose and mannose metabolism
    Tresu_0969
   00562 Inositol phosphate metabolism
    Tresu_0969
Enzymes [BR:tsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tresu_0969
Exosome [BR:tsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tresu_0969
  Exosomal proteins of bladder cancer cells
   Tresu_0969
  Exosomal proteins of melanoma cells
   Tresu_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1034136..1034885
Genome map
AA seq 249 aa AA seqDB search
MARTHYIAGNWKMNTSKAEAVKLASDLVSALKGKTNKFMIGVPFVYLDAVSQVVKGSNII
LAAQDCAATANGAHTGEVSTEMLKDLGVQCVILGHSERRHEIGESDELINKKVRRALNEG
LEVDLCIGELLADREAGNAEQVCAFQLSADLAGVTEEQMKRVTIAYEPVWAIGTGKTATP
EDAEAIHKFVRGYIAKLYNQKVADEVIIQYGGSMKASNAPELLAQPDIDGGLIGGASLKA
ETFVPICEC
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactcattatatcgccggaaactggaaaatgaacacttccaaagcggaagct
gtaaaacttgcatcggatttggtttccgcattgaaaggaaagacaaacaaatttatgatt
ggtgttccttttgtttaccttgatgctgtaagtcaggttgtaaaaggctcaaacattatt
cttgcggcccaggactgcgccgcgactgcaaacggagctcacacaggcgaagtttcaaca
gaaatgctcaaggatctcggagttcagtgtgtaattcttggacattcagaacgccgccac
gaaattggtgagtctgatgagcttatcaacaaaaaagttcgccgtgctttaaatgaaggc
ttggaagttgacctttgcattggagaacttcttgctgaccgtgaggcaggaaacgcagag
caggtttgcgcattccaactttctgcagatttggctggcgtaacagaagagcagatgaag
cgtgttacaatcgcttatgagcctgtttgggcaataggaactggaaaaactgcaactcca
gaagatgccgaggcaatccacaaatttgtccgtggatacattgcaaaactttacaatcag
aaagttgccgatgaagttataattcagtatggcggctcaatgaaagcttcaaatgctcca
gagcttttggctcagcctgatattgacggcggcttgattggcggagcttctttgaaagct
gaaacattcgttccaatctgcgagtgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system