KEGG   Treponema succinifaciens: Tresu_0969Help
Entry
Tresu_0969        CDS       T01461                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00010  Glycolysis / Gluconeogenesis
tsu00051  Fructose and mannose metabolism
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01120  Microbial metabolism in diverse environments
tsu01130  Biosynthesis of antibiotics
tsu01200  Carbon metabolism
tsu01230  Biosynthesis of amino acids
Module
tsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tsu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tresu_0969
   00051 Fructose and mannose metabolism
    Tresu_0969
   00562 Inositol phosphate metabolism
    Tresu_0969
Enzymes [BR:tsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tresu_0969
Exosome [BR:tsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tresu_0969
  Exosomal proteins of bladder cancer cells
   Tresu_0969
  Exosomal proteins of melanoma cells
   Tresu_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB13889
UniProt: F2NUQ8
Position
1034136..1034885
Genome map
AA seq 249 aa AA seqDB search
MARTHYIAGNWKMNTSKAEAVKLASDLVSALKGKTNKFMIGVPFVYLDAVSQVVKGSNII
LAAQDCAATANGAHTGEVSTEMLKDLGVQCVILGHSERRHEIGESDELINKKVRRALNEG
LEVDLCIGELLADREAGNAEQVCAFQLSADLAGVTEEQMKRVTIAYEPVWAIGTGKTATP
EDAEAIHKFVRGYIAKLYNQKVADEVIIQYGGSMKASNAPELLAQPDIDGGLIGGASLKA
ETFVPICEC
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactcattatatcgccggaaactggaaaatgaacacttccaaagcggaagct
gtaaaacttgcatcggatttggtttccgcattgaaaggaaagacaaacaaatttatgatt
ggtgttccttttgtttaccttgatgctgtaagtcaggttgtaaaaggctcaaacattatt
cttgcggcccaggactgcgccgcgactgcaaacggagctcacacaggcgaagtttcaaca
gaaatgctcaaggatctcggagttcagtgtgtaattcttggacattcagaacgccgccac
gaaattggtgagtctgatgagcttatcaacaaaaaagttcgccgtgctttaaatgaaggc
ttggaagttgacctttgcattggagaacttcttgctgaccgtgaggcaggaaacgcagag
caggtttgcgcattccaactttctgcagatttggctggcgtaacagaagagcagatgaag
cgtgttacaatcgcttatgagcctgtttgggcaataggaactggaaaaactgcaactcca
gaagatgccgaggcaatccacaaatttgtccgtggatacattgcaaaactttacaatcag
aaagttgccgatgaagttataattcagtatggcggctcaatgaaagcttcaaatgctcca
gagcttttggctcagcctgatattgacggcggcttgattggcggagcttctttgaaagct
gaaacattcgttccaatctgcgagtgctaa

DBGET integrated database retrieval system