KEGG   Treponema succinifaciens: Tresu_1044Help
Entry
Tresu_1044        CDS       T01461                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tsu  Treponema succinifaciens
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tresu_1044
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Tresu_1044
Enzymes [BR:tsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tresu_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108878..1109969
Genome map
AA seq 363 aa AA seqDB search
MKNVALKFLALPLVFFPLYSTTPAEKIWGRLSEIEKISQIFLVNVEGNETFYPVEFLEDG
AAVVPGGIILFSYNIGDSKEQLKNYISSINAFYKKNKSPLPFIAVDQEGGEVNRLKKITS
HLPSEKIISVNYTLQEAKSIYSNQAVQMKELGLTMNLAPVAEAEIESNKLFLGTRTFGSV
PKSVAYSMVCVRAYEENGIASVAKHFPGNANSDPHTGSVEITLSSSEVFKNFIFPFALIL
KSNPSCVLVSHAKINSLDENPACMSSFWIKEILQSRLGFEGLVMSDDIFMGAISDSPPEQ
VAANAIISGVDVIMLSEKKFLSVAKSLLNLAADDKFFATRLCEAEKKVLDFKLKKRIIKI
EEN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgcgctgaaatttcttgcattgccacttgttttttttcctttgtattca
acaactcctgctgaaaaaatttggggcagactttctgaaatagaaaaaatttcgcagatt
tttttagtcaatgttgaaggcaatgaaactttttatccagttgaatttcttgaagacgga
gcagcagttgtccctggcggaattattttgttttcttataatattggagattcaaaagag
cagctgaaaaattatatttcttcaataaatgctttttacaaaaaaaacaaaagtccgctt
ccttttattgcggttgatcaggaaggcggagaagttaaccgcttaaaaaaaatcacatca
catcttccttcggaaaaaataatcagcgtaaattatacattgcaagaagcgaagtcgatt
tattcaaatcaggcagtgcaaatgaaagaacttggactcacgatgaatcttgcgccagtt
gccgaagctgaaattgaatcaaataaattatttttaggaacaagaacttttggcagtgtc
ccaaagtcagttgcatacagcatggtttgtgtaagagcttacgaggaaaacggaattgct
tcggttgcaaaacattttccgggaaatgcgaattcagatcctcatactggctctgtagaa
ataacgctttcgtcttctgaagttttcaaaaattttatttttccatttgcattgatttta
aaatcgaatccatcttgtgttttggtaagccatgcaaaaataaattctcttgatgaaaat
ccggcttgcatgagcagtttttggataaaagaaattcttcagtcgaggcttggctttgaa
ggtcttgttatgagcgatgatatttttatgggagcgatttcagattcgcctccagaacaa
gttgctgcaaatgctataatttctggcgtggacgtgattatgcttagtgaaaaaaaattt
ctttcagttgcaaaatcgcttttaaatcttgctgcagacgataaattttttgcaactcgt
ctttgcgaggcagaaaaaaaagtgctggactttaaattaaaaaagaggattataaaaatt
gaagaaaactaa

DBGET integrated database retrieval system