KEGG   Treponema succinifaciens: Tresu_1279Help
Entry
Tresu_1279        CDS       T01461                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tsu  Treponema succinifaciens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tresu_1279
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tresu_1279
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tresu_1279
Enzymes [BR:tsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tresu_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1371469..1372881
Genome map
AA seq 470 aa AA seqDB search
MKYTDTRDKKVSVDFRTAVLNGMNAETGGLYMPTEFPRLENSFLERNPEPSFREIAYEMA
KPYVENEIPDTDLESIIQDCYPFSSKVVPIDPVTYVLELFHGPTCAFKDFGARFMARVMS
YFNRSENDNLHILVATSGDTGSAVGSAFHNVPGIDVTILYPDGKISPLQEKQLSTFTGNV
RALKVKGTFDDCQKLVKTAFTDKDLRSKFRLSSANSINISRLLPQSFYYMYSSLVVKKRI
PFDSKNGGDAIIVVVPSGNFGNLTSGLIAREMGAPITGFVAATNSNHTVPDWIASGEYKT
RPSVPTLSNAMDVGAPSNYERIDAMYSLDQVRNLFASYWTDDEGTIDGIKRCKNKTGYVI
DPHGAVAWKAWNDIRGGEMEKLVNGQKNDFTKPGLTPNVPFWAKAVVDKKASAIILETAH
PAKFGATVYKAIGQEPALPERLEKVVSLPDNAIPMGKDYDSFKEWLVSNL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacagatacaagagataaaaaagtaagtgttgattttagaactgcggttttg
aatggaatgaatgcagaaactggcggactttatatgccgactgaatttccgcgtcttgaa
aattcatttttggagcgcaatccagaaccttcattccgtgaaattgcctacgaaatggca
aagccttatgttgaaaatgaaattccagatactgacttggaatctataattcaggattgc
tatccattttcttcaaaagttgttcctattgatcctgtaacttatgtgcttgagcttttc
cacggaccgacctgtgcattcaaggattttggagcaaggtttatggcgcgcgtgatgtca
tatttcaatcgctcggaaaatgacaatcttcatattttggttgcaacttccggggataca
ggttctgctgtaggaagcgcgtttcacaatgttccgggaatcgacgttacaattctttat
ccggacggaaaaatttcaccattgcaggaaaaacagctttcaactttcacaggaaatgtc
cgcgcattgaaagtaaagggaacttttgacgactgccaaaaacttgttaaaactgcattt
acagataaagatttgagatccaagttcaggctttcttctgcaaactcaataaatatttcc
cgccttttgccgcagtctttctattatatgtattcatctcttgttgtaaaaaagagaatt
ccgtttgacagcaaaaatggaggagacgcaatcattgttgttgttccgagcggaaacttt
ggaaaccttacatcaggacttattgcgcgtgaaatgggagcgcctataacaggatttgtt
gctgcgacaaattctaaccatacagtgccggactggattgcaagcggtgaatacaaaact
cgcccttctgttccaacattaagcaatgcgatggatgttggagctcctagcaactatgaa
agaattgacgcaatgtattcgcttgaccaagtaagaaatctttttgcttcatactggact
gatgacgaaggaacaattgatggaataaaaagatgcaagaacaaaactggatacgtaata
gatccgcacggtgcagttgcctggaaagcatggaatgatattcgtggcggtgaaatggaa
aaacttgtaaacggccagaaaaatgattttacaaagcctggtcttacaccgaatgttcct
ttctgggcaaaagctgttgtagacaaaaaagcatctgcaataattcttgaaactgctcat
cctgcaaaattcggcgcgactgtttacaaggcaatcgggcaagagcctgctcttccagaa
cgtctcgaaaaggttgtttctcttcctgacaatgctattccaatgggcaaagattacgat
tcattcaaggaatggctggtttcaaacttgtag

DBGET integrated database retrieval system