KEGG   Treponema succinifaciens: Tresu_1314Help
Entry
Tresu_1314        CDS       T01461                                 

Definition
CoB--CoM heterodisulfide reductase (EC:1.8.98.1)
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
tsu  Treponema succinifaciens
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tresu_1314
  Energy metabolism
   00680 Methane metabolism
    Tresu_1314
Enzymes [BR:tsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, acceptors
    1.8.98.1  CoB---CoM heterodisulfide reductase
     Tresu_1314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412249..1413088
Genome map
AA seq 279 aa AA seqDB search
MSENQTHTLTYSYFPGCTLKNKAKDLDLYGRLSAEALGFKLEEIEEWQCCGGVYPTGKNE
IASKLPSVRALAASRDKNHALVTLCSACYNVIKQVNNDLQNDENTILKVNNYLAQDNIEY
HGETKVLHFLEVLRDEIGWDNVKKAVKNPFKGKKIGAYYGCLLLRPGKVMEFDDPENPKI
LEDFITAIGGTPVIYAQRNECCGAYAAFEDETIPQKRSASILANAEDMGADFLVTSCPLC
RYNLIKNKGSSKLDVIYFTELLAEALGVKDAVAKEAVNA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaaccagacacacacactgacttattcttattttccaggctgcacgctaaaa
aacaaagcgaaggatttggacttatacggtcgtttaagcgcggaagctcttggtttcaaa
cttgaagaaatcgaagagtggcagtgctgcggcggtgtatatcctacaggcaaaaatgaa
attgcctcaaagcttccttctgtccgggctttggctgcatccagagataagaaccatgca
ttggtaacactgtgctcagcgtgttacaatgtaatcaagcaggtgaacaatgacctgcag
aatgacgagaacacaattttaaaagtaaacaactatctcgcccaagacaatattgaatac
cacggagagacgaaagtccttcacttccttgaagttctccgtgatgagatcggctgggac
aacgtaaagaaggccgtcaagaatcctttcaagggaaagaaaatcggcgcctattacggc
tgtcttcttcttcgcccgggaaaggtgatggaatttgacgatccggagaatccgaaaatt
cttgaggacttcataaccgcaatcggcggaactccggtcatttatgcccagcgcaacgag
tgctgcggcgcctatgccgcgtttgaggacgaaacgattccccagaaaaggtcggcttcg
attcttgcgaacgccgaggacatgggagcagacttccttgtcacaagctgccctctgtgc
cgctacaatctcataaagaacaaaggctcctcaaagcttgatgtcatctactttacggaa
cttcttgcggaagctctcggcgtaaaggatgccgtggcaaaggaggctgtgaatgcttga

DBGET integrated database retrieval system