KEGG   Treponema succinifaciens: Tresu_1314Help
Entry
Tresu_1314        CDS       T01461                                 

Definition
CoB--CoM heterodisulfide reductase (EC:1.8.98.1)
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
tsu  Treponema succinifaciens
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tsu01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:tsu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412249..1413088
Genome map
AA seq 279 aa AA seqDB search
MSENQTHTLTYSYFPGCTLKNKAKDLDLYGRLSAEALGFKLEEIEEWQCCGGVYPTGKNE
IASKLPSVRALAASRDKNHALVTLCSACYNVIKQVNNDLQNDENTILKVNNYLAQDNIEY
HGETKVLHFLEVLRDEIGWDNVKKAVKNPFKGKKIGAYYGCLLLRPGKVMEFDDPENPKI
LEDFITAIGGTPVIYAQRNECCGAYAAFEDETIPQKRSASILANAEDMGADFLVTSCPLC
RYNLIKNKGSSKLDVIYFTELLAEALGVKDAVAKEAVNA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaaccagacacacacactgacttattcttattttccaggctgcacgctaaaa
aacaaagcgaaggatttggacttatacggtcgtttaagcgcggaagctcttggtttcaaa
cttgaagaaatcgaagagtggcagtgctgcggcggtgtatatcctacaggcaaaaatgaa
attgcctcaaagcttccttctgtccgggctttggctgcatccagagataagaaccatgca
ttggtaacactgtgctcagcgtgttacaatgtaatcaagcaggtgaacaatgacctgcag
aatgacgagaacacaattttaaaagtaaacaactatctcgcccaagacaatattgaatac
cacggagagacgaaagtccttcacttccttgaagttctccgtgatgagatcggctgggac
aacgtaaagaaggccgtcaagaatcctttcaagggaaagaaaatcggcgcctattacggc
tgtcttcttcttcgcccgggaaaggtgatggaatttgacgatccggagaatccgaaaatt
cttgaggacttcataaccgcaatcggcggaactccggtcatttatgcccagcgcaacgag
tgctgcggcgcctatgccgcgtttgaggacgaaacgattccccagaaaaggtcggcttcg
attcttgcgaacgccgaggacatgggagcagacttccttgtcacaagctgccctctgtgc
cgctacaatctcataaagaacaaaggctcctcaaagcttgatgtcatctactttacggaa
cttcttgcggaagctctcggcgtaaaggatgccgtggcaaaggaggctgtgaatgcttga

DBGET integrated database retrieval system